PDF-View the alignment by rendering the protein backbone. There are diffe

Author : calandra-battersby | Published Date : 2016-08-10

translate rotate How does the tool box icons 145mouse focus option146 145display options146 and 145display area options146 work Undisplay the proteins Display the

Presentation Embed Code

Download Presentation

Download Presentation The PPT/PDF document "View the alignment by rendering the prot..." is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.

View the alignment by rendering the protein backbone. There are diffe: Transcript

translate rotate How does the tool box icons 145mouse focus option146 145display options146 and 145display area options146 work Undisplay the proteins Display the ligands. By. Phil Sheperd. What is . BackBone. BackBone. is a . Javascript. Framework . How is this different From. jQuery. or Prototype?. Libraries . vs. Framework. BackBone. is a way to . structure your code. Janessa. . det. . – . lead front-end. . dev. @ . Thefuture.fm. Who am I?. Lead Front-End . Dev. at . Thefuture.fm. (formerly . Dubset. ). Columbia University MS in Computer Science. Vision/Graphics track w/ focus in UI/UX. Brian Kuhlman. University of North Carolina, Chapel Hill. Outline: Three Protein Design Stories . Using Flexible Backbone Design for the Complete Redesign of a Protein Core . Designing the Structure and Sequence of a Protein-Binding Peptide. Usman Roshan. BNFO 236. Gap penalties. How do we pick gap parameters to produce meaningful protein sequence alignments?. We use “true” alignments created manually (with some computational input) and with structure information. Tandy Warnow. The Department of Computer Science. The University of Texas at Austin. The “Tree of Life”. Avian Phylogenomics Project. G Zhang, . BGI. . Approx. 50 species, whole genomes. 8000+ genes, UCEs. In the beginning web applications were just static . HTML pages(HTML. , CSS, . JS). . Later. , in web 2.0, server side programming languages (like PHP, Ruby, Java, …) were added to generate HTML pages dynamically based on user input and data stored in database. . Beyond protein structure. Miguel . Andrade. Faculty of Biology, . Johannes Gutenberg University . Institute of Molecular Biology. Mainz, Germany. a. ndrade@uni-mainz.de. Transmembrane helices. N-terminal signals. By: Z. S. . Rezaei. Structural comparison. Structural alignment. spectrum. of structural alignment methods. The properties of output. Types of comparison. Algorithmic complexity. Representation of structures. Shiben. . Bhattacharjee. 200607022. shiben@research.iiit.ac.in. Advisor: . Prof. P. J. Narayanan. Why render terrains?. Terrains are a basic need in most graphics application. Geographical information systems. by . Sadhana S. definition. Protein structure prediction/protein . modelling. is the prediction of the three-dimensional structure of protein from its amino acid sequence. i.e., the prediction of its folding & its. and its implication in function prediction and complex detection. Hang Phan. Prof. Michael J.E. Sternberg. Division of Molecular Biosciences . Imperial College London. PhD Research Day April 1. st. 2011. What is . BackBone. BackBone. is a . Javascript. Framework . How is this different From. jQuery. or Prototype?. Libraries . vs. Framework. BackBone. is a way to . structure your code. Why/When should you use . Hsin. -Yu Chang. www.ebi.ac.uk. Classifying . proteins into families and . identifying . protein homologues can help scientists . to . characterise. unknown proteins. . . . Greider. and Blackburn discovered telomerase in 1984 and were awarded Nobel prize in 2009. Which model organism they used for this study ? . Secondary structures. Tertiary structures. MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDNGVDGEWTYTE. helices. strands. loops. Three dimensional packing of secondary structures. Protein Structures. Protein structures.

Download Document

Here is the link to download the presentation.
"View the alignment by rendering the protein backbone. There are diffe"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.