PPT-Word Meaning and Similarity
Author : giovanna-bartolotta | Published Date : 2016-09-13
Word Senses and Word Relations Reminder lemma and wordform A lemma or citation form Same stem part of speech rough semantics A wordfor m The inflected word
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "Word Meaning and Similarity" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
Word Meaning and Similarity: Transcript
Word Senses and Word Relations Reminder lemma and wordform A lemma or citation form Same stem part of speech rough semantics A wordfor m The inflected word as it appears in text. energies. D.A. . Artemenkov. , G.I. . . Lykasov. , . A.I. . . Malakhov. Joint Institute for Nuclear Research. malakhov@lhe.jinr.ru. Hadron Structure 2015, June 29 – July 3, 2015, . Horn. ý. . . Corpora and Statistical Methods. Lecture 6. Semantic similarity. Part 1. Synonymy. Different phonological. /orthographic. words. highly related meanings. :. sofa / couch. boy / lad. Traditional definition:. -. based Clustering. Mohammad. . Rezaei. , Pasi Fränti. rezaei@cs.uef.fi. Speech. and . Image. . Processing. . Unit. University of Eastern Finland. . August 2014. Keyword-Based Clustering. An object such as a text document, website, movie and service can be described by a set of keywords. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. Jing . Zhang, . Jie. . Tang . , Cong . Ma . , . Hanghang. . Tong . , Yu . Jing . , and . Juanzi. . Li. Presented by Moumita Chanda Das . Outline. Introduction. Problem formulation. Panther using path sampling. Story . #6 . – . My . Abuelita. wistful . wist-ful. . grateful grate-. ful. . grim gr-. im. raspy . ras-py. swarmed . swar. -med. revelers rev-el-. ers. irresistible . ir. -re-. sist. Story . #17. Nothing Happens on the Farm. hiatus . hi-a-. tus. embarked . em. -bar-ked. unimaginable . un-. im. -ag-in-able. extravagant . ex-. trav. -a-. gant. gourmet . gour. -met. throng . thr-ong. Dan Jurafsky. Stanford University. Introduction and Course Overview. What is Computational Lexical Semantics. Any computational process involving word meaning!. Computing . Word Similarity . Distributional (Vector) Models of . Warm Up. Solve each proportion.. 1.. . . 2.. . 3.. 4. . If . ∆. QRS . ~ . ∆. XYZ. , identify the pairs of congruent angles and write 3 proportions using pairs of corresponding sides.. . computing the similarity between words. “. fast. ” is similar to “. rapid. ”. “. tall. ” is similar to “. height. ”. Question answering:. Q. : “. How . tall. . is Mt. Everest?”. Candidate A: “The . Presenter. : Monica Farkash. Bryan Hickerson. . mfarkash@us.ibm.com. . bhickers@us.ibm.com. . 2. Outline. The challenge: Providing a subset from a regression test suite. Our new Jaccard/K-means (JK) approach . Quiz. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. 3. Deer-mouse. 4. Deer-roof. Quiz Answer. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. Jessica Chackoria. 1. , Brooke Nyberg. 1. , Melissa Vazquez. 1 . Suzanne Bell. 2. , . Alla. Vinokhodova. 3. , Vadim Gushin. 3. , Leslie DeChurch. 4 . , Noshir Contractor. 4 . 1. DePaul University, . Sketching, Locality Sensitive Hashing. SIMILARITY AND DISTANCE. Thanks to:. Tan, Steinbach, . and Kumar, “Introduction to Data Mining”. Rajaraman. . and . Ullman, “Mining Massive Datasets”. Similarity and Distance.
Download Document
Here is the link to download the presentation.
"Word Meaning and Similarity"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
Related Documents