PPT-PROTEIN STRUCTURE SIMILARITY CALCULATION AND VISUALIZATION

CMPS 561FALL 2014 SUMI SINGH SXS5729 Protein Structure 2 RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ Primary Structure Sequence of Amino Acids Not enough for functional prediction Tertiary Structure. SUMI SINGH. (sxs5729). Levels of Protein Structure. 2. Thanks to: Frank . Lloyd . Wright for graphics. WOOD, BRICK etc. . . material/building blocks . AMINO ACIDS. *****************************************************************. Sequence:. Edman degradation. Mass spectrometry. Secondary structure:. Circular Dichroism. FTIR. Tertiary, quaternary structure:. NMR. X-ray crystallography. Protein sequencing approaches depend on what is known and what is the goal. C483 Spring 2013. 1. Which . statement is false about a globular protein that performs its biological function as a single independent polypeptide chain?. A. ) Its tertiary structure is likely stabilized by the interactions of amino acid side chains . Alexey Onufriev, . Virginia Tech. www.cs.vt.edu/~onufriev. Proteins play key roles in a living system. Three (out of many many) examples of protein functions. Catalysis:. Almost all chemical reactions in a living cell are catalyzed by protein enzymes.. PROTEIN STRUCTURE. To understand how drugs interact it is necessary to understand their structure.. Proteins have four level of structure:-. PRIMARY . SECONDARY. TERTIARY. QUATERNARY. 1.PRIMARY STRUCTURE:-. Alexey Onufriev, . Virginia Tech. www.cs.vt.edu/~onufriev. Proteins play key roles in a living system. Three (out of many many) examples of protein functions. Catalysis:. Almost all chemical reactions in a living cell are catalyzed by protein enzymes.. Sequence:. Edman degradation. Mass spectrometry. Secondary structure:. Circular Dichroism. FTIR. Tertiary, quaternary structure:. NMR. X-ray crystallography. Protein sequencing approaches depend on what is known and what is the goal. Contains . carbon, hydrogen. , oxygen, and nitrogen. Remember carbohydrates and lipids contain carbon, hydrogen, and oxygen – SO protein adds . nitrogen. Some proteins also contain sulfur, iron. , copper, phosphorus, or . Dr. . Shaimaa. . Munther. . Learning Outcomes - Proteins. Define the levels of protein conformation and to indicate the role of weak interactions.. Illustrate how protein structure relates to protein function using examples.. Proteins are biopolymers, made of the 20 L- . α. -amino acids linked by peptide bonds.. Polypeptide backbone is a repeating sequence of. . N-C-C-N-C-C…. The side chain or R group is not a part of the backbone or the peptide bond.. Prediction . Wang Yang. 2014.1.3. Outline. Molecular. . Co-evolution . phenomenon. A. pplications . of Co-evolution . in . protein structure prediction and PPI prediction.. Co-evolution measurement: . Virginia Tech. www.cs.vt.edu/~onufriev. Gene is protein. ’. s blueprint, genome is life. ’. s blueprint . Gene. Genome. DNA. Protein. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. This has proved to be a very challenging problem. It has aptly been described as the second half of the genetic code, and as the three-dimensional code, as opposed to the one-dimensional code involved in nucleotide/amino acid sequence. . HMC 2012. what is MLST?. powerful population genetics technique . DNA sequences . of . internal fragments of . multiple. genes. . identifies allelic variants . to . characteri. ze. , subtyp. e. . and .