PPT-PROTEIN STRUCTURE SIMILARITY CALCULATION AND VISUALIZATION

Author : tatyana-admore | Published Date : 2016-06-26

CMPS 561FALL 2014 SUMI SINGH SXS5729 Protein Structure 2 RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ Primary Structure Sequence of Amino Acids Not enough for functional prediction

Presentation Embed Code

Download Presentation

Download Presentation The PPT/PDF document "PROTEIN STRUCTURE SIMILARITY CALCULATION..." is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.

PROTEIN STRUCTURE SIMILARITY CALCULATION AND VISUALIZATION: Transcript

CMPS 561FALL 2014 SUMI SINGH SXS5729 Protein Structure 2 RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ Primary Structure Sequence of Amino Acids Not enough for functional prediction Tertiary Structure. Subtract the Date of Joining if it is before 15111995 from 15111995 duly rounding the service in years Find out the salary as on 15111995 as to wh ether it is upto Rs2500 or more than Rs2500 Accordingly locate the past service bene fit from the tabl Bamshad Mobasher. DePaul University. Distance or Similarity Measures. Many data mining and analytics tasks involve the comparison of objects and determining . their . similarities (or dissimilarities). B.Tech Major Project. Project Guide. Dr. . Naresh. . Nagwani. Project Team Members. Pawan Singh. Sumit. . Guha. What is Data Visualisation ?. Data Visualisation . is the graphical representation. of information. Bar charts, scatter graphs, and. energies. D.A. . Artemenkov. , G.I. . . Lykasov. , . A.I. . . Malakhov. Joint Institute for Nuclear Research. malakhov@lhe.jinr.ru. Hadron Structure 2015, June 29 – July 3, 2015, . Horn. ý. . . Corpora and Statistical Methods. Lecture 6. Semantic similarity. Part 1. Synonymy. Different phonological. /orthographic. words. highly related meanings. :. sofa / couch. boy / lad. Traditional definition:. Theory and Applications. Danai Koutra (CMU). Tina Eliassi-Rad (Rutgers) . Christos Faloutsos (CMU). SDM 2014. , Friday April 25. th. 2014, Philadelphia, PA. Who we are. Danai Koutra, CMU. Node and graph similarity,. Gustavo Caetano - . Anolles. 1. PowerPoint by Casey . Hanson. Protein Sequence, Structure, and Function | Gustavo Caetano - Anolles | 2015. Exercise. In this exercise we will be doing the following:. of. Cost of goods sold. is much more complex. for a manufacturing firm. Calculation. of . Cost of Goods Manufactured. and. Cost of Goods Sold. Calculation. Calculation. Calculation. Calculation. Calculation. Week . 9 . NJ Kang. What is creative visualization?. 5. Create new and fresh/. From language to visualization. http://pageturneradventures.com/2011/09/imagination-workout-visualization/. From word to image. Warm Up. Solve each proportion.. 1.. . . 2.. . 3.. 4. . If . ∆. QRS . ~ . ∆. XYZ. , identify the pairs of congruent angles and write 3 proportions using pairs of corresponding sides.. . Proteins are major components of all cellular systems. Proteins consist of one or more linear polymers called polypeptides. Proteins are linear and never branched. Different AA’s are linked together via . VBC-603. P.G.. 30.12.2020. Protein . Strucuture. Sequence, Structure and Function. What determines fold?. Anfinsen’s experiments in 1957 demonstrated that proteins can fold spontaneously into their native conformations under physiological conditions. This implies that primary structure does indeed determine folding or 3-D . Quiz. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. 3. Deer-mouse. 4. Deer-roof. Quiz Answer. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. Proteins are biopolymers, made of the 20 L- . α. -amino acids linked by peptide bonds.. Polypeptide backbone is a repeating sequence of. . N-C-C-N-C-C…. The side chain or R group is not a part of the backbone or the peptide bond..

Download Document

Here is the link to download the presentation.
"PROTEIN STRUCTURE SIMILARITY CALCULATION AND VISUALIZATION"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.