PPT-Protein Sequence, Structure, and Function Lab

Gustavo Caetano Anolles 1 PowerPoint by Casey Hanson Protein Sequence Structure and Function Gustavo Caetano Anolles 2015 Exercise In this exercise we will be doing the following. Sequence:. Edman degradation. Mass spectrometry. Secondary structure:. Circular Dichroism. FTIR. Tertiary, quaternary structure:. NMR. X-ray crystallography. Protein sequencing approaches depend on what is known and what is the goal. Alexey Onufriev, . Virginia Tech. www.cs.vt.edu/~onufriev. Proteins play key roles in a living system. Three (out of many many) examples of protein functions. Catalysis:. Almost all chemical reactions in a living cell are catalyzed by protein enzymes.. Day 3 - SAMS Program. Will . Foran. Sam Sanford . Objectives. What is the Central Dogma?. DNA Translation. Exercise 1 - DNA Transcription. RNA Translation. Exercise 2 - RNA Translation . Proteins. Protein Structure Analysis. Alexey Onufriev, . Virginia Tech. www.cs.vt.edu/~onufriev. Proteins play key roles in a living system. Three (out of many many) examples of protein functions. Catalysis:. Almost all chemical reactions in a living cell are catalyzed by protein enzymes.. Miguel . Andrade. Faculty of Biology, . Johannes Gutenberg University . Institute of Molecular Biology. Mainz, Germany. a. ndrade@uni-mainz.de. X-ray crystallography . (103,988 . in PDB). need crystals. Sequence:. Edman degradation. Mass spectrometry. Secondary structure:. Circular Dichroism. FTIR. Tertiary, quaternary structure:. NMR. X-ray crystallography. Protein sequencing approaches depend on what is known and what is the goal. Part II: Proteins & Nucleic Acids. The FOUR Classes of Large Biomolecules. All living things are made up of four classes of large biological molecules: . Carbohydrates . Lipids. Protein. N. ucleic Acids. The Structure and Function of Macromolecules Part II: Proteins & Nucleic Acids The FOUR Classes of Large Biomolecules All living things are made up of four classes of large biological molecules: for . life.. . The importance of proteins was recognized by chemists in the early 19th century, including Swedish chemist . Jöns. Jacob Berzelius. , who in 1838 coined the term . protein. , a word derived from the Greek . VBC-603. P.G.. 02.01.2021. Knowledge Based Approaches. Homology Modelling. Need homologues of known protein structure. Backbone modelling. Side chain modelling . Fail in absence of homology. Threading Based Methods. L7. Dicitionary. . matching. Pattern matching. Fa05. CSE 182. Dictionary Matching. Q: Given k words (s. i. has length l. i. ). , . and a database of size n, find all matches to these words in the database string.. Virginia Tech. www.cs.vt.edu/~onufriev. Gene is protein. ’. s blueprint, genome is life. ’. s blueprint . Gene. Genome. DNA. Protein. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Proteins are naturally-occurring biopolymers comprised of amino acids. . The biological function of proteins is inherent in their three dimensional structure.. All the information required for correct folding of the protein into its functional . Secondary structures. Tertiary structures. MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDNGVDGEWTYTE. helices. strands. loops. Three dimensional packing of secondary structures. Protein Structures. Protein structures.