PPT-Methods for determining protein structure
Author : pamella-moone | Published Date : 2017-10-27
Sequence Edman degradation Mass spectrometry Secondary structure Circular Dichroism FTIR Tertiary quaternary structure NMR Xray crystallography Protein sequencing
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "Methods for determining protein structur..." is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
Methods for determining protein structure: Transcript
Sequence Edman degradation Mass spectrometry Secondary structure Circular Dichroism FTIR Tertiary quaternary structure NMR Xray crystallography Protein sequencing approaches depend on what is known and what is the goal. Sequence:. Edman degradation. Mass spectrometry. Secondary structure:. Circular Dichroism. FTIR. Tertiary, quaternary structure:. NMR. X-ray crystallography. Protein sequencing approaches depend on what is known and what is the goal. C483 Spring 2013. 1. Which . statement is false about a globular protein that performs its biological function as a single independent polypeptide chain?. A. ) Its tertiary structure is likely stabilized by the interactions of amino acid side chains . CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. Gustavo Caetano - . Anolles. 1. PowerPoint by Casey . Hanson. Protein Sequence, Structure, and Function | Gustavo Caetano - Anolles | 2015. Exercise. In this exercise we will be doing the following:. Alexey Onufriev, . Virginia Tech. www.cs.vt.edu/~onufriev. Proteins play key roles in a living system. Three (out of many many) examples of protein functions. Catalysis:. Almost all chemical reactions in a living cell are catalyzed by protein enzymes.. PROTEIN STRUCTURE. To understand how drugs interact it is necessary to understand their structure.. Proteins have four level of structure:-. PRIMARY . SECONDARY. TERTIARY. QUATERNARY. 1.PRIMARY STRUCTURE:-. Contains . carbon, hydrogen. , oxygen, and nitrogen. Remember carbohydrates and lipids contain carbon, hydrogen, and oxygen – SO protein adds . nitrogen. Some proteins also contain sulfur, iron. , copper, phosphorus, or . What to Know. What are some protein functions?. General principles for protein folding. General structural features of globular and structural proteins. Know the 4 common globular protein motifs. Understand how protein structures are stabilized and why some portions of proteins are marginally stable. . SYFTET. Göteborgs universitet ska skapa en modern, lättanvänd och . effektiv webbmiljö med fokus på användarnas förväntningar.. 1. ETT UNIVERSITET – EN GEMENSAM WEBB. Innehåll som är intressant för de prioriterade målgrupperna samlas på ett ställe till exempel:. Chapter 5and endonuclease activitiesPagentroduction Chapter 5Determining minimal regions of XisA protein displaying recombinase and endonuclease activitiesChapter 5Determining minimal regions of XisA VBC-603. P.G.. 30.12.2020. Protein . Strucuture. Sequence, Structure and Function. What determines fold?. Anfinsen’s experiments in 1957 demonstrated that proteins can fold spontaneously into their native conformations under physiological conditions. This implies that primary structure does indeed determine folding or 3-D . Localized arrangement of adjacent amino acids formed as the polypeptide chain folds.. The regions of ordered structures formed by interaction of hydrogen bond donor and hydrogen bond acceptor residues of the repeating peptide unit. Virginia Tech. www.cs.vt.edu/~onufriev. Gene is protein. ’. s blueprint, genome is life. ’. s blueprint . Gene. Genome. DNA. Protein. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Swanand. Gore & Gerard . Kleywegt. PDBe. – EBI. May 7. th. 2010, 9-10 am. Macromolecular Crystallography Course. Outline. Structural Biology and Bioinformatics. Databases in Structural Bioinformatics.
Download Document
         Here is the link to download the presentation.
"Methods for determining protein structure"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
	 
        
Related Documents

 
         
         
         
         
         
         
         
         
         
         
         
         
        