PPT-Protein Structure
Author : pamella-moone | Published Date : 2016-05-04
C483 Spring 2013 1 Which statement is false about a globular protein that performs its biological function as a single independent polypeptide chain A Its tertiary
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "Protein Structure" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
Protein Structure: Transcript
C483 Spring 2013 1 Which statement is false about a globular protein that performs its biological function as a single independent polypeptide chain A Its tertiary structure is likely stabilized by the interactions of amino acid side chains . Sequence:. Edman degradation. Mass spectrometry. Secondary structure:. Circular Dichroism. FTIR. Tertiary, quaternary structure:. NMR. X-ray crystallography. Protein sequencing approaches depend on what is known and what is the goal. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. Gustavo Caetano - . Anolles. 1. PowerPoint by Casey . Hanson. Protein Sequence, Structure, and Function | Gustavo Caetano - Anolles | 2015. Exercise. In this exercise we will be doing the following:. Alexey Onufriev, . Virginia Tech. www.cs.vt.edu/~onufriev. Proteins play key roles in a living system. Three (out of many many) examples of protein functions. Catalysis:. Almost all chemical reactions in a living cell are catalyzed by protein enzymes.. Sequence:. Edman degradation. Mass spectrometry. Secondary structure:. Circular Dichroism. FTIR. Tertiary, quaternary structure:. NMR. X-ray crystallography. Protein sequencing approaches depend on what is known and what is the goal. Contains . carbon, hydrogen. , oxygen, and nitrogen. Remember carbohydrates and lipids contain carbon, hydrogen, and oxygen – SO protein adds . nitrogen. Some proteins also contain sulfur, iron. , copper, phosphorus, or . What to Know. What are some protein functions?. General principles for protein folding. General structural features of globular and structural proteins. Know the 4 common globular protein motifs. Understand how protein structures are stabilized and why some portions of proteins are marginally stable. by . Sadhana S. definition. Protein structure prediction/protein . modelling. is the prediction of the three-dimensional structure of protein from its amino acid sequence. i.e., the prediction of its folding & its. In a day and age where people have busier lifestyles, where obesity is becoming a trend, and homes becoming smaller – manufacturers have created an empire surrounding quick and easy meals, snacks, and even drinks. More people prefer instant gratification, which led to wanting things done in an instant – instant messaging, instant coffee, instant noodles, and even instant meals! VBC-603. P.G.. 02.01.2021. Knowledge Based Approaches. Homology Modelling. Need homologues of known protein structure. Backbone modelling. Side chain modelling . Fail in absence of homology. Threading Based Methods. Prediction . Wang Yang. 2014.1.3. Outline. Molecular. . Co-evolution . phenomenon. A. pplications . of Co-evolution . in . protein structure prediction and PPI prediction.. Co-evolution measurement: . Virginia Tech. www.cs.vt.edu/~onufriev. Gene is protein. ’. s blueprint, genome is life. ’. s blueprint . Gene. Genome. DNA. Protein. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. This has proved to be a very challenging problem. It has aptly been described as the second half of the genetic code, and as the three-dimensional code, as opposed to the one-dimensional code involved in nucleotide/amino acid sequence. . Swanand. Gore & Gerard . Kleywegt. PDBe. – EBI. May 7. th. 2010, 9-10 am. Macromolecular Crystallography Course. Outline. Structural Biology and Bioinformatics. Databases in Structural Bioinformatics.
Download Document
Here is the link to download the presentation.
"Protein Structure"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
Related Documents