PPT-Protein structure prediction and design- II

Author : WiseWolf | Published Date : 2022-08-03

VBC603 PG 02012021 Knowledge Based Approaches Homology Modelling Need homologues of known protein structure Backbone modelling Side chain modelling Fail in absence

Presentation Embed Code

Download Presentation

Download Presentation The PPT/PDF document "Protein structure prediction and design-..." is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.

Protein structure prediction and design- II: Transcript


VBC603 PG 02012021 Knowledge Based Approaches Homology Modelling Need homologues of known protein structure Backbone modelling Side chain modelling Fail in absence of homology Threading Based Methods. Why do we want to know protein structure?. Classification. Functional Prediction. What is protein structure?. Primary - chains of amino acids. Secondary - interaction between groups of amino acids. Tertiary - the organization in three dimensions of all the atoms in a polypeptide. What can we compare?. 3D shapes (RMSD). Atomic motions (B-value, RMSF). Solvent accessibilities (SASA). AMIGOS - Reads an RNA PDB file and outputs a complete table of torsion angle calculations.. APBS - Software for evaluating the electrostatic properties of . Brian Kuhlman. University of North Carolina, Chapel Hill. Outline: Three Protein Design Stories . Using Flexible Backbone Design for the Complete Redesign of a Protein Core . Designing the Structure and Sequence of a Protein-Binding Peptide. Beyond protein structure. Miguel . Andrade. Faculty of Biology, . Johannes Gutenberg University . Institute of Molecular Biology. Mainz, Germany. a. ndrade@uni-mainz.de. Transmembrane helices. N-terminal signals. Avdesh Mishra, . Md. . Tamjidul. . Hoque. {amishra2, . thoque. }@uno.edu. Presented By: Avdesh Mishra. Department of Computer Science. Protein structure in its native state gains lowest free energy. Miguel . Andrade. Faculty of Biology, . Johannes Gutenberg University . Institute of Molecular Biology. Mainz, Germany. a. ndrade@uni-mainz.de. X-ray crystallography . (103,988 . in PDB). need crystals. Advisor: Dr. Chen . Keasar. Arie Barsky, Nadav Nuni. Protein folding problem. Proteins are responsible for constructing and operating the organism, and are made of chains of amino-acids. Protein folding problem. przewidywania struktury białek Magdalena Mozolewska Instytut Podstaw Informatyki PAN Importance • In most cases function of the proteins depends strictly on their structure: • denatured enzymes VBC-603. P.G.. 30.12.2020. Protein . Strucuture. Sequence, Structure and Function. What determines fold?. Anfinsen’s experiments in 1957 demonstrated that proteins can fold spontaneously into their native conformations under physiological conditions. This implies that primary structure does indeed determine folding or 3-D . computer science, mathematics, information technology and statistics. to analyze the biological data like . genomics, Protein structure prediction, . Pharmaco-phore. modeling , toxicity prediction and drug designing.. Question. Why design novel proteins? . what can be gained by the design and characterization of novel proteins? . Can we design 3D protein structures that have never been observed?. Are the 3D structures that have not been observed in nature unattainable, or just . Prediction . Wang Yang. 2014.1.3. Outline. Molecular. . Co-evolution . phenomenon. A. pplications . of Co-evolution . in . protein structure prediction and PPI prediction.. Co-evolution measurement: . Some of the slides are adapted from Dr. Dong Xu’s lecture notes. Why secondary structure prediction?. Accurate secondary structure prediction can be an important information for the tertiary structure prediction. Secondary structures. Tertiary structures. MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDNGVDGEWTYTE. helices. strands. loops. Three dimensional packing of secondary structures. Protein Structures. Protein structures.

Download Document

Here is the link to download the presentation.
"Protein structure prediction and design- II"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.

Related Documents