PPT-19.4 Protein Structure: Primary
Author : calandra-battersby | Published Date : 2017-06-25
and Secondary Levels The secondary structure of a protein describes the structure that forms when amino acids form hydrogen bonds between the atoms in the backbone
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "19.4 Protein Structure: Primary" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
19.4 Protein Structure: Primary: Transcript
and Secondary Levels The secondary structure of a protein describes the structure that forms when amino acids form hydrogen bonds between the atoms in the backbone and atoms on the same or another peptide chain. C483 Spring 2013. 1. Which . statement is false about a globular protein that performs its biological function as a single independent polypeptide chain?. A. ) Its tertiary structure is likely stabilized by the interactions of amino acid side chains . PROTEIN STRUCTURE. To understand how drugs interact it is necessary to understand their structure.. Proteins have four level of structure:-. PRIMARY . SECONDARY. TERTIARY. QUATERNARY. 1.PRIMARY STRUCTURE:-. Alexey Onufriev, . Virginia Tech. www.cs.vt.edu/~onufriev. Proteins play key roles in a living system. Three (out of many many) examples of protein functions. Catalysis:. Almost all chemical reactions in a living cell are catalyzed by protein enzymes.. Sequence:. Edman degradation. Mass spectrometry. Secondary structure:. Circular Dichroism. FTIR. Tertiary, quaternary structure:. NMR. X-ray crystallography. Protein sequencing approaches depend on what is known and what is the goal. Proteins account for more than 50% of the dry mass of most cells. Protein functions include structural support, storage, transport, cellular communications, movement, and defense against foreign substances. Proteins. The Role of Enzymes. Success criteria. By the end of this lesson we will be able to:. State what elements are found in proteins. Describe what is meant by primary, secondary and tertiary structure of proteins.. Contains . carbon, hydrogen. , oxygen, and nitrogen. Remember carbohydrates and lipids contain carbon, hydrogen, and oxygen – SO protein adds . nitrogen. Some proteins also contain sulfur, iron. , copper, phosphorus, or . Part II: Proteins & Nucleic Acids. The FOUR Classes of Large Biomolecules. All living things are made up of four classes of large biological molecules: . Carbohydrates . Lipids. Protein. N. ucleic Acids. The Structure and Function of Macromolecules Part II: Proteins & Nucleic Acids The FOUR Classes of Large Biomolecules All living things are made up of four classes of large biological molecules: Dr. . Shaimaa. . Munther. . Learning Outcomes - Proteins. Define the levels of protein conformation and to indicate the role of weak interactions.. Illustrate how protein structure relates to protein function using examples.. Proteins are biopolymers, made of the 20 L- . α. -amino acids linked by peptide bonds.. Polypeptide backbone is a repeating sequence of. . N-C-C-N-C-C…. The side chain or R group is not a part of the backbone or the peptide bond.. Virginia Tech. www.cs.vt.edu/~onufriev. Gene is protein. ’. s blueprint, genome is life. ’. s blueprint . Gene. Genome. DNA. Protein. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Proteins are naturally-occurring biopolymers comprised of amino acids. . The biological function of proteins is inherent in their three dimensional structure.. All the information required for correct folding of the protein into its functional . Secondary structures. Tertiary structures. MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDNGVDGEWTYTE. helices. strands. loops. Three dimensional packing of secondary structures. Protein Structures. Protein structures.
Download Document
Here is the link to download the presentation.
"19.4 Protein Structure: Primary"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
Related Documents