PPT-Protein Secondary Structure Prediction
Author : hailey | Published Date : 2023-11-21
Some of the slides are adapted from Dr Dong Xus lecture notes Why secondary structure prediction Accurate secondary structure prediction can be an important information
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "Protein Secondary Structure Prediction" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
Protein Secondary Structure Prediction: Transcript
Some of the slides are adapted from Dr Dong Xus lecture notes Why secondary structure prediction Accurate secondary structure prediction can be an important information for the tertiary structure prediction. C483 Spring 2013. 1. Which . statement is false about a globular protein that performs its biological function as a single independent polypeptide chain?. A. ) Its tertiary structure is likely stabilized by the interactions of amino acid side chains . Gustavo Caetano - . Anolles. 1. PowerPoint by Casey . Hanson. Protein Sequence, Structure, and Function | Gustavo Caetano - Anolles | 2015. Exercise. In this exercise we will be doing the following:. PROTEIN STRUCTURE. To understand how drugs interact it is necessary to understand their structure.. Proteins have four level of structure:-. PRIMARY . SECONDARY. TERTIARY. QUATERNARY. 1.PRIMARY STRUCTURE:-. and Secondary Levels. The . secondary structure . of a protein describes the structure that forms when amino acids form hydrogen bonds between the atoms in the backbone and atoms on the same or another peptide chain.. loops (coil). Bovine . carboxypeptidase. A. Figure 6-28. Tertiary . structures . may contain . common patterns, or motifs, of secondary structures (= . supersecondary. structures) . βαβ. β. -hairpins. loops (coil). Bovine . carboxypeptidase. A. Figure 6-28. Tertiary . structures . may contain . common patterns, or motifs, of secondary structures (= . supersecondary. structures) . βαβ. β. -hairpins. Proteins are major components of all cellular systems. Proteins consist of one or more linear polymers called polypeptides. Proteins are linear and never branched. Different AA’s are linked together via . . Miguel . Andrade. Faculty of Biology, . Johannes Gutenberg University . Institute of Molecular Biology. Mainz, Germany. a. ndrade@uni-mainz.de. Secondary structure prediction. Amino acid sequence -> Secondary structure. BMI/CS 776 . www.biostat.wisc.edu/bmi776/. Spring . 2018. Anthony Gitter. gitter@biostat.wisc.edu. These slides, excluding third-party material, are licensed . under . CC BY-NC 4.0. by Mark . Craven, Colin Dewey, and Anthony Gitter. VBC-603. P.G.. 02.01.2021. Knowledge Based Approaches. Homology Modelling. Need homologues of known protein structure. Backbone modelling. Side chain modelling . Fail in absence of homology. Threading Based Methods. Dr. . Shaimaa. . Munther. . Learning Outcomes - Proteins. Define the levels of protein conformation and to indicate the role of weak interactions.. Illustrate how protein structure relates to protein function using examples.. , . Brent O. . Cezairliyan. , Robert A. Grant, Jesse C. . Cochrane, . and Robert T. . Sauer - . Department . of Biology, Massachusetts Institute of Technology, Cambridge, MA 02139 . Presented by . Gayathri Priya Ravichandran. Virginia Tech. www.cs.vt.edu/~onufriev. Gene is protein. ’. s blueprint, genome is life. ’. s blueprint . Gene. Genome. DNA. Protein. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Gene. Secondary structures. Tertiary structures. MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDNGVDGEWTYTE. helices. strands. loops. Three dimensional packing of secondary structures. Protein Structures. Protein structures.
Download Document
Here is the link to download the presentation.
"Protein Secondary Structure Prediction"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
Related Documents