PPT-Distance and Similarity Measures
Author : test | Published Date : 2016-03-25
Bamshad Mobasher DePaul University Distance or Similarity Measures Many data mining and analytics tasks involve the comparison of objects and determining their
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "Distance and Similarity Measures" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
Distance and Similarity Measures: Transcript
Bamshad Mobasher DePaul University Distance or Similarity Measures Many data mining and analytics tasks involve the comparison of objects and determining their similarities or dissimilarities. Presented by:. Akshay. Kumar. Pankaj. . Prateek. Are these similar?. Number ‘1’ vs. color ‘red’. Number ‘1’ vs. ‘small’. Horse vs. Rider. True vs. false . ‘. Monalisa. ’ vs. ‘Virgin of the rocks’. Corpora and Statistical Methods. Lecture 6. Semantic similarity. Part 1. Synonymy. Different phonological. /orthographic. words. highly related meanings. :. sofa / couch. boy / lad. Traditional definition:. -. based Clustering. Mohammad. . Rezaei. , Pasi Fränti. rezaei@cs.uef.fi. Speech. and . Image. . Processing. . Unit. University of Eastern Finland. . August 2014. Keyword-Based Clustering. An object such as a text document, website, movie and service can be described by a set of keywords. from . GOMMA. Michael . Hartung. , Lars Kolb, . Anika. . Groß. , Erhard Rahm. Database . Research Group. University of . Leipzig. 9th . Intl. . . Conf. . on Data Integration. in . the. Life . Sciences. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. Ciro . Cattuto. , Dominik Benz, Andreas . Hotho. , . Gerd. . Stumme. Presented by. Smitashree. . Choudhury. Overview. Motivation. Measures of . semantic Relatedness. Semantic . Grounding of measures. WordNet. Lubomir. . Stanchev. Example . Similarity Graph. Dog. Cat. 0.3. 0.3. Animal. 0.8. 0.2. 0.8. 0.2. Applications. If we type . automobile. . in our favorite Internet search engine, for example Google or Bing, then all top results will contain the word . Case-based reasoning. Introduction. Common term in everyday language, where two objects usually are considered similar if they look or sound similar. Similarity is a core concept within CBR. From a CBR perspective: «Two problems are similar if they have similar solutions». Jing . Zhang, . Jie. . Tang . , Cong . Ma . , . Hanghang. . Tong . , Yu . Jing . , and . Juanzi. . Li. Presented by Moumita Chanda Das . Outline. Introduction. Problem formulation. Panther using path sampling. a Multi-Layered Indexing Approach. Yongjiang Liang, . Peixiang Zhao. CS @ FSU. zhao@cs.fsu.edu. Outline. Introduction. State-of-the-art solutions. ML-Index & similarity search. Experiments. Conclusion. Centrality. , Similarity, and . Influence. Edith Cohen . Tel Aviv University. Graph Datasets:. Represent relations between “things”. Bowtie structure of the Web . Broder. et. al. 2001. Dolphin interactions. CS159 . Fall . 2014. Admin. Assignment 4. Quiz #2 Thursday. Same . rules as quiz #1. First 30 minutes of class. Open book and . notes. Assignment 5 out on Thursday. Quiz #2. Topics. Linguistics 101. Parsing. Bamshad Mobasher. DePaul University. Distance or Similarity Measures. Many data mining and analytics tasks involve the comparison of objects and determining in terms of their similarities (or dissimilarities). Financial Services. Dhagash. Mehta. BlackRock, Inc.. Disclaimer: The views expresses here are those of the authors alone and not of BlackRock, Inc.. Introduction: Similarity. Scene from Alice’s Adventures in Wonderland by Lewis Carroll, 1865. Artist: John Tenniel.
Download Document
Here is the link to download the presentation.
"Distance and Similarity Measures"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
Related Documents