PPT-Creating a Similarity Graph from

Author : mitsue-stanley | Published Date : 2016-07-13

WordNet Lubomir Stanchev Example Similarity Graph Dog Cat 03 03 Animal 08 02 08 02 Applications If we type automobile in our favorite Internet search engine

Presentation Embed Code

Download Presentation

Download Presentation The PPT/PDF document "Creating a Similarity Graph from" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.

Creating a Similarity Graph from: Transcript


WordNet Lubomir Stanchev Example Similarity Graph Dog Cat 03 03 Animal 08 02 08 02 Applications If we type automobile in our favorite Internet search engine for example Google or Bing then all top results will contain the word . Presented by:. Akshay. Kumar. Pankaj. . Prateek. Are these similar?. Number ‘1’ vs. color ‘red’. Number ‘1’ vs. ‘small’. Horse vs. Rider. True vs. false . ‘. Monalisa. ’ vs. ‘Virgin of the rocks’. Bamshad Mobasher. DePaul University. Distance or Similarity Measures. Many data mining and analytics tasks involve the comparison of objects and determining . their . similarities (or dissimilarities). energies. D.A. . Artemenkov. , G.I. . . Lykasov. , . A.I. . . Malakhov. Joint Institute for Nuclear Research. malakhov@lhe.jinr.ru. Hadron Structure 2015, June 29 – July 3, 2015, . Horn. ý. . . . Multi-label Protein Subcellular Localization. Shibiao WAN and Man-Wai MAK. The Hong Kong Polytechnic University. Sun-Yuan KUNG. Princeton University. Outline. Introduction and Motivation. Retrieval of GO Terms. Corpora and Statistical Methods. Lecture 6. Semantic similarity. Part 1. Synonymy. Different phonological. /orthographic. words. highly related meanings. :. sofa / couch. boy / lad. Traditional definition:. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. Arijit Khan, . Yinghui. Wu, Xifeng Yan. Department of Computer Science. University of California, Santa Barbara. {. arijitkhan. , . yinghui. , . xyan. }@. cs.ucsb.edu. Graph Data. 2. Graphs are everywhere.. Warm Up. 1.. . If . ∆. QRS.  . ∆. ZYX. , identify the pairs of congruent angles and the pairs of congruent sides.. Solve each proportion.. 2.. . 3.. . . x . = 9. x . = 18. . Q. Case-based reasoning. Introduction. Common term in everyday language, where two objects usually are considered similar if they look or sound similar. Similarity is a core concept within CBR. From a CBR perspective: «Two problems are similar if they have similar solutions». CSE, HKUST. March 20. Recap. String declaration. str1=“Hong”. str2=“Kong”. String Operators. strr. =str1+str2. “H” in . strr. String Slicing. strr. [. i. ]. strr. [:. i. ]. strr. [. i. :]. CS159 . Fall . 2014. Admin. Assignment 4. Quiz #2 Thursday. Same . rules as quiz #1. First 30 minutes of class. Open book and . notes. Assignment 5 out on Thursday. Quiz #2. Topics. Linguistics 101. Parsing. Presenter. : Monica Farkash. Bryan Hickerson. . mfarkash@us.ibm.com. . bhickers@us.ibm.com. . 2. Outline. The challenge: Providing a subset from a regression test suite. Our new Jaccard/K-means (JK) approach . Deduplication o f large amounts of code Romain Keramitas FOSDEM 2019 Clones def foo(name: str): print('Hello World, my name is ' + name) def bar(name: str): print('Hello World, my name is {}'.format(name)) Rosalia F. Tungaraza. Advisor: Prof. Linda G. Shapiro. Ph.D. Defense. Computer Science & Engineering. University of Washington. 1. Functional Brain Imaging. Study how the brain works . Imaging while subject performs a task .

Download Document

Here is the link to download the presentation.
"Creating a Similarity Graph from"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.

Related Documents