PPT-Similarity
Author : min-jolicoeur | Published Date : 2016-12-20
Warm Up 1 If QRS ZYX identify the pairs of congruent angles and the pairs of congruent sides Solve each proportion 2 3 x 9 x 18 Q
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "Similarity" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
Similarity: Transcript
Warm Up 1 If QRS ZYX identify the pairs of congruent angles and the pairs of congruent sides Solve each proportion 2 3 x 9 x 18 Q. Bamshad Mobasher. DePaul University. Distance or Similarity Measures. Many data mining and analytics tasks involve the comparison of objects and determining . their . similarities (or dissimilarities). Corpora and Statistical Methods. Lecture 6. Semantic similarity. Part 1. Synonymy. Different phonological. /orthographic. words. highly related meanings. :. sofa / couch. boy / lad. Traditional definition:. from . GOMMA. Michael . Hartung. , Lars Kolb, . Anika. . Groß. , Erhard Rahm. Database . Research Group. University of . Leipzig. 9th . Intl. . . Conf. . on Data Integration. in . the. Life . Sciences. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. these theories have explanatory power domains partially role of relational judgments. Previous structural and aspects of notion of relational similarity by the fact that and her some ways there is in Word . Similarity: . Distributional Similarity (I). Problems with thesaurus-based . meaning. We don’t have a thesaurus for every language. Even if we do, . they have problems with . recall. M. any . Case-based reasoning. Introduction. Common term in everyday language, where two objects usually are considered similar if they look or sound similar. Similarity is a core concept within CBR. From a CBR perspective: «Two problems are similar if they have similar solutions». Jing . Zhang, . Jie. . Tang . , Cong . Ma . , . Hanghang. . Tong . , Yu . Jing . , and . Juanzi. . Li. Presented by Moumita Chanda Das . Outline. Introduction. Problem formulation. Panther using path sampling. a Multi-Layered Indexing Approach. Yongjiang Liang, . Peixiang Zhao. CS @ FSU. zhao@cs.fsu.edu. Outline. Introduction. State-of-the-art solutions. ML-Index & similarity search. Experiments. Conclusion. CS159 . Fall . 2014. Admin. Assignment 4. Quiz #2 Thursday. Same . rules as quiz #1. First 30 minutes of class. Open book and . notes. Assignment 5 out on Thursday. Quiz #2. Topics. Linguistics 101. Parsing. Bamshad Mobasher. DePaul University. Distance or Similarity Measures. Many data mining and analytics tasks involve the comparison of objects and determining in terms of their similarities (or dissimilarities). Text Similarity. Motivation. People can express the same concept (or related concepts) in many different ways. For example, “the plane leaves at 12pm” vs “the flight departs at noon”. Text similarity is a key component of Natural Language Processing. Jessica Chackoria. 1. , Brooke Nyberg. 1. , Melissa Vazquez. 1 . Suzanne Bell. 2. , . Alla. Vinokhodova. 3. , Vadim Gushin. 3. , Leslie DeChurch. 4 . , Noshir Contractor. 4 . 1. DePaul University, . Sketching, Locality Sensitive Hashing. SIMILARITY AND DISTANCE. Thanks to:. Tan, Steinbach, . and Kumar, “Introduction to Data Mining”. Rajaraman. . and . Ullman, “Mining Massive Datasets”. Similarity and Distance.
Download Document
Here is the link to download the presentation.
"Similarity"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
Related Documents