PPT-Distance and Similarity Measures
Author : tatyana-admore | Published Date : 2019-03-16
Bamshad Mobasher DePaul University Distance or Similarity Measures Many data mining and analytics tasks involve the comparison of objects and determining in terms
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "Distance and Similarity Measures" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
Distance and Similarity Measures: Transcript
Bamshad Mobasher DePaul University Distance or Similarity Measures Many data mining and analytics tasks involve the comparison of objects and determining in terms of their similarities or dissimilarities. energies. D.A. . Artemenkov. , G.I. . . Lykasov. , . A.I. . . Malakhov. Joint Institute for Nuclear Research. malakhov@lhe.jinr.ru. Hadron Structure 2015, June 29 – July 3, 2015, . Horn. ý. . . Theory and Applications. Danai Koutra (CMU). Tina Eliassi-Rad (Rutgers) . Christos Faloutsos (CMU). SDM 2014. , Friday April 25. th. 2014, Philadelphia, PA. Who we are. Danai Koutra, CMU. Node and graph similarity,. -. based Clustering. Mohammad. . Rezaei. , Pasi Fränti. rezaei@cs.uef.fi. Speech. and . Image. . Processing. . Unit. University of Eastern Finland. . August 2014. Keyword-Based Clustering. An object such as a text document, website, movie and service can be described by a set of keywords. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. Ciro . Cattuto. , Dominik Benz, Andreas . Hotho. , . Gerd. . Stumme. Presented by. Smitashree. . Choudhury. Overview. Motivation. Measures of . semantic Relatedness. Semantic . Grounding of measures. these theories have explanatory power domains partially role of relational judgments. Previous structural and aspects of notion of relational similarity by the fact that and her some ways there is in Pattern Recognition . 2015/2016. Marc van Kreveld. Measures in mathematics. Functions from “subsets” to the reals. A . measure. obeys the properties:. Non-. negativeness. : for any subset X, f(X) . Warm Up. 1.. . If . ∆. QRS. . ∆. ZYX. , identify the pairs of congruent angles and the pairs of congruent sides.. Solve each proportion.. 2.. . 3.. . . x . = 9. x . = 18. . Q. Word . Similarity: . Distributional Similarity (I). Problems with thesaurus-based . meaning. We don’t have a thesaurus for every language. Even if we do, . they have problems with . recall. M. any . Case-based reasoning. Introduction. Common term in everyday language, where two objects usually are considered similar if they look or sound similar. Similarity is a core concept within CBR. From a CBR perspective: «Two problems are similar if they have similar solutions». Jing . Zhang, . Jie. . Tang . , Cong . Ma . , . Hanghang. . Tong . , Yu . Jing . , and . Juanzi. . Li. Presented by Moumita Chanda Das . Outline. Introduction. Problem formulation. Panther using path sampling. Centrality. , Similarity, and . Influence. Edith Cohen . Tel Aviv University. Graph Datasets:. Represent relations between “things”. Bowtie structure of the Web . Broder. et. al. 2001. Dolphin interactions. Warm Up. Solve each proportion.. 1.. . . 2.. . 3.. 4. . If . ∆. QRS . ~ . ∆. XYZ. , identify the pairs of congruent angles and write 3 proportions using pairs of corresponding sides.. . Text Similarity. Motivation. People can express the same concept (or related concepts) in many different ways. For example, “the plane leaves at 12pm” vs “the flight departs at noon”. Text similarity is a key component of Natural Language Processing.
Download Document
Here is the link to download the presentation.
"Distance and Similarity Measures"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
Related Documents
