PPT-Similarity Search in Graph Databases:
Author : tatiana-dople | Published Date : 2017-08-28
a MultiLayered Indexing Approach Yongjiang Liang Peixiang Zhao CS FSU zhaocsfsuedu Outline Introduction Stateoftheart solutions MLIndex amp similarity search Experiments
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "Similarity Search in Graph Databases:" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
Similarity Search in Graph Databases:: Transcript
a MultiLayered Indexing Approach Yongjiang Liang Peixiang Zhao CS FSU zhaocsfsuedu Outline Introduction Stateoftheart solutions MLIndex amp similarity search Experiments Conclusion. Presented by:. Akshay. Kumar. Pankaj. . Prateek. Are these similar?. Number ‘1’ vs. color ‘red’. Number ‘1’ vs. ‘small’. Horse vs. Rider. True vs. false . ‘. Monalisa. ’ vs. ‘Virgin of the rocks’. Sarvesh. . Nagarajan. What is Neo4j?. Graph . Databases. Cypher. Application Domains. Outline. Developed by Neo Technologies. Most Popular Graph Database. Implemented in Java. Open Source. What is Neo4j. . Multi-label Protein Subcellular Localization. Shibiao WAN and Man-Wai MAK. The Hong Kong Polytechnic University. Sun-Yuan KUNG. Princeton University. Outline. Introduction and Motivation. Retrieval of GO Terms. Theory and Applications. Danai Koutra (CMU). Tina Eliassi-Rad (Rutgers) . Christos Faloutsos (CMU). SDM 2014. , Friday April 25. th. 2014, Philadelphia, PA. Who we are. Danai Koutra, CMU. Node and graph similarity,. Frederic Murray. Assistant Professor . MLIS, University of British Columbia. BA, Political Science, University of Iowa. . Instructional Services Librarian. Al Harris Library . frederic.murray@swosu.edu. from . GOMMA. Michael . Hartung. , Lars Kolb, . Anika. . Groß. , Erhard Rahm. Database . Research Group. University of . Leipzig. 9th . Intl. . . Conf. . on Data Integration. in . the. Life . Sciences. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. Jane Long. MLIS, University of Oklahoma. MA, Wright State University. Reference Services Librarian. Al Harris Library . jane.long@swosu.edu. How do I get started?. 1. . Keywords. 2. Boolean Operators. Warm Up. 1.. . If . ∆. QRS. . ∆. ZYX. , identify the pairs of congruent angles and the pairs of congruent sides.. Solve each proportion.. 2.. . 3.. . . x . = 9. x . = 18. . Q. Word . Similarity: . Distributional Similarity (I). Problems with thesaurus-based . meaning. We don’t have a thesaurus for every language. Even if we do, . they have problems with . recall. M. any . Tour of the major . molecular biology databases. A database is an . indexed. . collection. of information. There is a tremendous amount of information about biomolecules in publicly available databases. . Jing . Zhang, . Jie. . Tang . , Cong . Ma . , . Hanghang. . Tong . , Yu . Jing . , and . Juanzi. . Li. Presented by Moumita Chanda Das . Outline. Introduction. Problem formulation. Panther using path sampling. presentation and training. Databases. Databases contain information gathered from thousands of scholarly journals, books, book series, reports, conferences, and more. . Databases can be used for narrowing/ enlarging the research topic, verifying citations, and protocols/ patent search. . Quiz. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. 3. Deer-mouse. 4. Deer-roof. Quiz Answer. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse.
Download Document
Here is the link to download the presentation.
"Similarity Search in Graph Databases:"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
Related Documents
