PPT-Similarity Search in Graph Databases:

a MultiLayered Indexing Approach Yongjiang Liang Peixiang Zhao CS FSU zhaocsfsuedu Outline Introduction Stateoftheart solutions MLIndex amp similarity search Experiments Conclusion. Presented by:. Akshay. Kumar. Pankaj. . Prateek. Are these similar?. Number ‘1’ vs. color ‘red’. Number ‘1’ vs. ‘small’. Horse vs. Rider. True vs. false . ‘. Monalisa. ’ vs. ‘Virgin of the rocks’. Sarvesh. . Nagarajan. What is Neo4j?. Graph . Databases. Cypher. Application Domains. Outline. Developed by Neo Technologies. Most Popular Graph Database. Implemented in Java. Open Source. What is Neo4j. . Multi-label Protein Subcellular Localization. Shibiao WAN and Man-Wai MAK. The Hong Kong Polytechnic University. Sun-Yuan KUNG. Princeton University. Outline. Introduction and Motivation. Retrieval of GO Terms. Theory and Applications. Danai Koutra (CMU). Tina Eliassi-Rad (Rutgers) . Christos Faloutsos (CMU). SDM 2014. , Friday April 25. th. 2014, Philadelphia, PA. Who we are. Danai Koutra, CMU. Node and graph similarity,. Frederic Murray. Assistant Professor . MLIS, University of British Columbia. BA, Political Science, University of Iowa. . Instructional Services Librarian. Al Harris Library . frederic.murray@swosu.edu. from . GOMMA. Michael . Hartung. , Lars Kolb, . Anika. . Groß. , Erhard Rahm. Database . Research Group. University of . Leipzig. 9th . Intl. . . Conf. . on Data Integration. in . the. Life . Sciences. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. Jane Long. MLIS, University of Oklahoma. MA, Wright State University. Reference Services Librarian. Al Harris Library . jane.long@swosu.edu. How do I get started?. 1. . Keywords. 2. Boolean Operators. Warm Up. 1.. . If . ∆. QRS.  . ∆. ZYX. , identify the pairs of congruent angles and the pairs of congruent sides.. Solve each proportion.. 2.. . 3.. . . x . = 9. x . = 18. . Q. Word . Similarity: . Distributional Similarity (I). Problems with thesaurus-based . meaning. We don’t have a thesaurus for every language. Even if we do, . they have problems with . recall. M. any . Tour of the major . molecular biology databases. A database is an . indexed. . collection. of information. There is a tremendous amount of information about biomolecules in publicly available databases. . Jing . Zhang, . Jie. . Tang . , Cong . Ma . , . Hanghang. . Tong . , Yu . Jing . , and . Juanzi. . Li. Presented by Moumita Chanda Das . Outline. Introduction. Problem formulation. Panther using path sampling. presentation and training. Databases. Databases contain information gathered from thousands of scholarly journals, books, book series, reports, conferences, and more. . Databases can be used for narrowing/ enlarging the research topic, verifying citations, and protocols/ patent search. . Quiz. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. 3. Deer-mouse. 4. Deer-roof. Quiz Answer. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse.