PPT-String Similarity

CSE HKUST March 20 Recap String declaration str1Hong str2Kong String Operators strr str1str2 H in strr String Slicing strr i strr i strr i . Presented by:. Akshay. Kumar. Pankaj. . Prateek. Are these similar?. Number ‘1’ vs. color ‘red’. Number ‘1’ vs. ‘small’. Horse vs. Rider. True vs. false . ‘. Monalisa. ’ vs. ‘Virgin of the rocks’. energies. D.A. . Artemenkov. , G.I. . . Lykasov. , . A.I. . . Malakhov. Joint Institute for Nuclear Research. malakhov@lhe.jinr.ru. Hadron Structure 2015, June 29 – July 3, 2015, . Horn. ý. . . . Multi-label Protein Subcellular Localization. Shibiao WAN and Man-Wai MAK. The Hong Kong Polytechnic University. Sun-Yuan KUNG. Princeton University. Outline. Introduction and Motivation. Retrieval of GO Terms. Corpora and Statistical Methods. Lecture 6. Semantic similarity. Part 1. Synonymy. Different phonological. /orthographic. words. highly related meanings. :. sofa / couch. boy / lad. Traditional definition:. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. these theories have explanatory power domains partially role of relational judgments. Previous structural and aspects of notion of relational similarity by the fact that and her some ways there is in Warm Up. 1.. . If . ∆. QRS.  . ∆. ZYX. , identify the pairs of congruent angles and the pairs of congruent sides.. Solve each proportion.. 2.. . 3.. . . x . = 9. x . = 18. . Q. Jing . Zhang, . Jie. . Tang . , Cong . Ma . , . Hanghang. . Tong . , Yu . Jing . , and . Juanzi. . Li. Presented by Moumita Chanda Das . Outline. Introduction. Problem formulation. Panther using path sampling. Storing strings. Reading text input by line. Concatenating strings. Checking for matching string at beginning. Finding a substring within a larger string. Counting . occurances. in a string (e.g. how many vowels). Warm Up. Solve each proportion.. 1.. . . 2.. . 3.. 4. . If . ∆. QRS . ~ . ∆. XYZ. , identify the pairs of congruent angles and write 3 proportions using pairs of corresponding sides.. . with Edit-Distance Constraints. Dong . Deng . (. Tsinghua, . Beijing, China. ). Guoliang. Li . (. Tsinghua, . Beijing, China. ). Jianhua. Feng. . (Tsinghua, Beijing, China). Wen-. Syan. Li(SAP Labs, Shanghai, China). Presenter. : Monica Farkash. Bryan Hickerson. . mfarkash@us.ibm.com. . bhickers@us.ibm.com. . 2. Outline. The challenge: Providing a subset from a regression test suite. Our new Jaccard/K-means (JK) approach . Text Similarity. Motivation. People can express the same concept (or related concepts) in many different ways. For example, “the plane leaves at 12pm” vs “the flight departs at noon”. Text similarity is a key component of Natural Language Processing. Rosalia F. Tungaraza. Advisor: Prof. Linda G. Shapiro. Ph.D. Defense. Computer Science & Engineering. University of Washington. 1. Functional Brain Imaging. Study how the brain works . Imaging while subject performs a task .