PPT-Similarity Learning in
Author : madeline | Published Date : 2024-07-09
Financial Services Dhagash Mehta BlackRock Inc Disclaimer The views expresses here are those of the authors alone and not of BlackRock Inc Introduction Similarity
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "Similarity Learning in" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
Similarity Learning in: Transcript
Financial Services Dhagash Mehta BlackRock Inc Disclaimer The views expresses here are those of the authors alone and not of BlackRock Inc Introduction Similarity Scene from Alices Adventures in Wonderland by Lewis Carroll 1865 Artist John Tenniel. energies. D.A. . Artemenkov. , G.I. . . Lykasov. , . A.I. . . Malakhov. Joint Institute for Nuclear Research. malakhov@lhe.jinr.ru. Hadron Structure 2015, June 29 – July 3, 2015, . Horn. ý. . . Theory and Applications. Danai Koutra (CMU). Tina Eliassi-Rad (Rutgers) . Christos Faloutsos (CMU). SDM 2014. , Friday April 25. th. 2014, Philadelphia, PA. Who we are. Danai Koutra, CMU. Node and graph similarity,. from . GOMMA. Michael . Hartung. , Lars Kolb, . Anika. . Groß. , Erhard Rahm. Database . Research Group. University of . Leipzig. 9th . Intl. . . Conf. . on Data Integration. in . the. Life . Sciences. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. these theories have explanatory power domains partially role of relational judgments. Previous structural and aspects of notion of relational similarity by the fact that and her some ways there is in Warm Up. 1.. . If . ∆. QRS. . ∆. ZYX. , identify the pairs of congruent angles and the pairs of congruent sides.. Solve each proportion.. 2.. . 3.. . . x . = 9. x . = 18. . Q. Word . Similarity: . Distributional Similarity (I). Problems with thesaurus-based . meaning. We don’t have a thesaurus for every language. Even if we do, . they have problems with . recall. M. any . Case-based reasoning. Introduction. Common term in everyday language, where two objects usually are considered similar if they look or sound similar. Similarity is a core concept within CBR. From a CBR perspective: «Two problems are similar if they have similar solutions». Jing . Zhang, . Jie. . Tang . , Cong . Ma . , . Hanghang. . Tong . , Yu . Jing . , and . Juanzi. . Li. Presented by Moumita Chanda Das . Outline. Introduction. Problem formulation. Panther using path sampling. CSE, HKUST. March 20. Recap. String declaration. str1=“Hong”. str2=“Kong”. String Operators. strr. =str1+str2. “H” in . strr. String Slicing. strr. [. i. ]. strr. [:. i. ]. strr. [. i. :]. CS159 . Fall . 2014. Admin. Assignment 4. Quiz #2 Thursday. Same . rules as quiz #1. First 30 minutes of class. Open book and . notes. Assignment 5 out on Thursday. Quiz #2. Topics. Linguistics 101. Parsing. Moitreya Chatterjee, . Yunan. . Luo. Image Source: Google. Outline – This Section. Why do we need Similarity Measures. Metric Learning as a measure of Similarity. Notion of a metric. Unsupervised Metric Learning. Warm Up. Solve each proportion.. 1.. . . 2.. . 3.. 4. . If . ∆. QRS . ~ . ∆. XYZ. , identify the pairs of congruent angles and write 3 proportions using pairs of corresponding sides.. . Sketching, Locality Sensitive Hashing. SIMILARITY AND DISTANCE. Thanks to:. Tan, Steinbach, . and Kumar, “Introduction to Data Mining”. Rajaraman. . and . Ullman, “Mining Massive Datasets”. Similarity and Distance.
Download Document
Here is the link to download the presentation.
"Similarity Learning in"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
Related Documents
