PPT-16.3 Proteins: Primary Structure
Author : white | Published Date : 2022-06-11
A peptide bond is an amide bond that forms when the COO group of one amino acid reacts with the NH 3 group of the next amino acid The linking of two or more
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "16.3 Proteins: Primary Structure" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
16.3 Proteins: Primary Structure: Transcript
A peptide bond is an amide bond that forms when the COO group of one amino acid reacts with the NH 3 group of the next amino acid The linking of two or more amino acids by peptide bonds forms a . SUMI SINGH. (sxs5729). Levels of Protein Structure. 2. Thanks to: Frank . Lloyd . Wright for graphics. WOOD, BRICK etc. . . material/building blocks . AMINO ACIDS. *****************************************************************. 2. Proteins. Proteins are polymers made of monomers called amino acids. All proteins are made of 20 different amino acids linked in different orders. Proteins are used to build cells, act as hormones & enzymes, and do much of the work in a cell. P. art . 3. Proteins. Proteins!. Functions of Proteins. Structural . support. Storage. Transport. Cellular . communications. Movement. Defense . against foreign . substances. Proteins. Monomer: amino acids. . from lack of structure to. pleiotropy. of functions. Lilia Iakoucheva. University of California, San Diego. Ordered Proteins. Disordered Proteins. Uversky and Dunker, 2012, Anal . Chem. Outline. The 20 different amino acids. 7.5.1: Explain the four levels of protein structure, indicating the significance of each level.. Peptide bonds link the amino acids together . Polypeptide with five amino acids. . CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. PROTEINS – (DR. TRAISH) Introduction to Proteins - Proteins are abundant and functionally diverse molecules - They participate in cell regulation at all levels - They share a common structural Levels of Protein Structure. Primary 1º Structure. The primary structure is simply the sequence of amino acids in a protein.. Chains of amino acids are written from the amino terminus (N-terminus) to the carboxyl terminus (C-terminus).. 2. Proteins (. Polypeptides. ). Chains of Amino acids (. 20. different kinds). bonded together by . peptide bonds. . (. polypeptides. ). Made of . Nitrogen, Carbon, Oxygen, and Hydrogen. Functions:. B.2. Properties of 2-amino acids . (B.2.2). Zwitterion. (dipolar) . amino acids contain both acidic and basic groups in the same molecule . therefore, are . amphoteric. in nature (capable of behaving as acids or bases). Proteins account for more than 50% of the dry mass of most cells. Protein functions include structural support, storage, transport, cellular communications, movement, and defense against foreign substances. Proteins. The Role of Enzymes. Success criteria. By the end of this lesson we will be able to:. State what elements are found in proteins. Describe what is meant by primary, secondary and tertiary structure of proteins.. The concentration of many of these are affected by pathological processes; they are therefore measured.. They contain disulphide bonds.. Functions of plasma proteins include:. Transport. Maintaining plasma . Proteins are biopolymers, made of the 20 L- . α. -amino acids linked by peptide bonds.. Polypeptide backbone is a repeating sequence of. . N-C-C-N-C-C…. The side chain or R group is not a part of the backbone or the peptide bond..
Download Document
Here is the link to download the presentation.
"16.3 Proteins: Primary Structure"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
Related Documents
