PPT-Understanding the structure of a protein involved in Parkin
Author : kittie-lecroy | Published Date : 2017-11-19
Bharath Peddibhotla httpimgwebmdcomdtmcmslivewebmdconsumerassetssiteimagesarticlethumbnailsnews2012062012parkinsonsbrainstimulation493x335parkinsonsbrainstimulationjpgresize400pxampoutputquality50
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "Understanding the structure of a protein..." is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
Understanding the structure of a protein involved in Parkin: Transcript
Bharath Peddibhotla httpimgwebmdcomdtmcmslivewebmdconsumerassetssiteimagesarticlethumbnailsnews2012062012parkinsonsbrainstimulation493x335parkinsonsbrainstimulationjpgresize400pxampoutputquality50. Sequence:. Edman degradation. Mass spectrometry. Secondary structure:. Circular Dichroism. FTIR. Tertiary, quaternary structure:. NMR. X-ray crystallography. Protein sequencing approaches depend on what is known and what is the goal. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. Alexey Onufriev, . Virginia Tech. www.cs.vt.edu/~onufriev. Proteins play key roles in a living system. Three (out of many many) examples of protein functions. Catalysis:. Almost all chemical reactions in a living cell are catalyzed by protein enzymes.. PROTEIN STRUCTURE. To understand how drugs interact it is necessary to understand their structure.. Proteins have four level of structure:-. PRIMARY . SECONDARY. TERTIARY. QUATERNARY. 1.PRIMARY STRUCTURE:-. and Secondary Levels. The . secondary structure . of a protein describes the structure that forms when amino acids form hydrogen bonds between the atoms in the backbone and atoms on the same or another peptide chain.. Sequence:. Edman degradation. Mass spectrometry. Secondary structure:. Circular Dichroism. FTIR. Tertiary, quaternary structure:. NMR. X-ray crystallography. Protein sequencing approaches depend on what is known and what is the goal. Contains . carbon, hydrogen. , oxygen, and nitrogen. Remember carbohydrates and lipids contain carbon, hydrogen, and oxygen – SO protein adds . nitrogen. Some proteins also contain sulfur, iron. , copper, phosphorus, or . What to Know. What are some protein functions?. General principles for protein folding. General structural features of globular and structural proteins. Know the 4 common globular protein motifs. Understand how protein structures are stabilized and why some portions of proteins are marginally stable. La gamme de thé MORPHEE vise toute générations recherchant le sommeil paisible tant désiré et non procuré par tout types de médicaments. Essentiellement composé de feuille de morphine, ce thé vous assurera d’un rétablissement digne d’un voyage sur . MATT KOCI Ph.D. Viral pathogenesis, University of Georgia M.S. Infectious diseases, University of Georgia B.S. Biology, Virginia Tech RESEARCH INTERESTS My laboratory works to understand the immune me Proteins are major components of all cellular systems. Proteins consist of one or more linear polymers called polypeptides. Proteins are linear and never branched. Different AA’s are linked together via . Dr. . Shaimaa. . Munther. . Learning Outcomes - Proteins. Define the levels of protein conformation and to indicate the role of weak interactions.. Illustrate how protein structure relates to protein function using examples.. Prediction . Wang Yang. 2014.1.3. Outline. Molecular. . Co-evolution . phenomenon. A. pplications . of Co-evolution . in . protein structure prediction and PPI prediction.. Co-evolution measurement: . Swanand. Gore & Gerard . Kleywegt. PDBe. – EBI. May 7. th. 2010, 9-10 am. Macromolecular Crystallography Course. Outline. Structural Biology and Bioinformatics. Databases in Structural Bioinformatics.
Download Document
         Here is the link to download the presentation.
"Understanding the structure of a protein involved in Parkin"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
	 
        
Related Documents

 
         
         
         
         
         
         
         
         
         
         
         
         
        