PPT-9-6 Dilations You identified dilations and verified them as similarity transformations.

Author : lois-ondreau | Published Date : 2018-09-30

Draw dilations Draw dilations in the coordinate plane Definitions A dilation or scaling is a similarity transformation that enlarges or reduces a figure proportionally

Presentation Embed Code

Download Presentation

Download Presentation The PPT/PDF document "9-6 Dilations You identified dilations a..." is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.

9-6 Dilations You identified dilations and verified them as similarity transformations.: Transcript


Draw dilations Draw dilations in the coordinate plane Definitions A dilation or scaling is a similarity transformation that enlarges or reduces a figure proportionally with respect to a center point and a scale factor. 1 2D Transformations Given a point cloud polygon or sampled parametric curve w e can use transformations for several purposes 1 Change coordinate frames world window viewport devic e etc 2 Compose objects of simple parts with local scaleposition orie . November 5, 2012. . Ms. Smith. Mrs. Malone. DO NOW. :. Date. : . November 5, 2012. 6.9C . demonstrate . energy transformations such as how energy in a flashlight battery changes from chemical energy to electrical energy to light energy.. energies. D.A. . Artemenkov. , G.I. . . Lykasov. , . A.I. . . Malakhov. Joint Institute for Nuclear Research. malakhov@lhe.jinr.ru. Hadron Structure 2015, June 29 – July 3, 2015, . Horn. ý. . . Corpora and Statistical Methods. Lecture 6. Semantic similarity. Part 1. Synonymy. Different phonological. /orthographic. words. highly related meanings. :. sofa / couch. boy / lad. Traditional definition:. Theory and Applications. Danai Koutra (CMU). Tina Eliassi-Rad (Rutgers) . Christos Faloutsos (CMU). SDM 2014. , Friday April 25. th. 2014, Philadelphia, PA. Who we are. Danai Koutra, CMU. Node and graph similarity,. Lecture 3. Jitendra. Malik. Pose and Shape. Rotations and reflections are examples. of orthogonal transformations . Rigid body motions. (Euclidean transformations / . isometries. ). Theorem:. Any rigid body motion can be expressed as an orthogonal transformation followed by a translation.. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. Rishabh. Singh and . Sumit. . Gulwani. FlashFill. Transformations. Syntactic Transformations . Concatenation of regular expression based substring. “VLDB2012” .  “VLDB”. Semantic Transformations. Maurice J. . Chacron. and Kathleen E. Cullen. Outline. Lecture 1: . - Introduction to sensorimotor . . transformations. - . The case of “linear” sensorimotor . transformations: . Agenda. Embedded Assessment Review. Triangles Cut by Parallel Lines. Dilations. Similarity Shortcuts: AA. Debrief. DO NOW 12/8: . Write an equation that will . show the tree’s height (h) in . terms of the shadow (s) . By Brit Caswell. What is a Dilation?. Pg. 587. A stretch! . Think of Ant Man!. Is a dilation a rigid motion?. If the scale factor is . <. 1. , the dilation is called a . reduction. .. If the scale factor is . in real life. HW: Maintenance Sheet 3 . (7-8). I can use the properties of translations, rotations, and reflections on line segments, angles, parallel lines or geometric figures. . I can show and explain two figures are congruent using transformations (explaining the series of transformations used) . Quiz. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. 3. Deer-mouse. 4. Deer-roof. Quiz Answer. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. CSE 455. Ali Farhadi. Many slides from Steve Seitz and Larry . Zitnick. What are geometric transformations?. Translation. Preserves: Orientation. Translation and rotation. Scale. Similarity transformations.

Download Document

Here is the link to download the presentation.
"9-6 Dilations You identified dilations and verified them as similarity transformations."The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.

Related Documents