PPT-Dilations and Similarity Shortcuts

Agenda Embedded Assessment Review Triangles Cut by Parallel Lines Dilations Similarity Shortcuts AA Debrief DO NOW 128 Write an equation that will show the trees height h in terms of the shadow s . energies. D.A. . Artemenkov. , G.I. . . Lykasov. , . A.I. . . Malakhov. Joint Institute for Nuclear Research. malakhov@lhe.jinr.ru. Hadron Structure 2015, June 29 – July 3, 2015, . Horn. ý. . . -. based Clustering. Mohammad. . Rezaei. , Pasi Fränti. rezaei@cs.uef.fi. Speech. and . Image. . Processing. . Unit. University of Eastern Finland. . August 2014. Keyword-Based Clustering. An object such as a text document, website, movie and service can be described by a set of keywords. from . GOMMA. Michael . Hartung. , Lars Kolb, . Anika. . Groß. , Erhard Rahm. Database . Research Group. University of . Leipzig. 9th . Intl. . . Conf. . on Data Integration. in . the. Life . Sciences. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. Lesson of the Month (December). Shortcuts for the Account . Shift + Command + Q: Log off. Control + Eject: Restart/Sleep/Shut Down. Command + Alt (Option) . + esc: . Force Quit application. Command + Tab: Shifts between applications. WordNet. Lubomir. . Stanchev. Example . Similarity Graph. Dog. Cat. 0.3. 0.3. Animal. 0.8. 0.2. 0.8. 0.2. Applications. If we type . automobile. . in our favorite Internet search engine, for example Google or Bing, then all top results will contain the word . these theories have explanatory power domains partially role of relational judgments. Previous structural and aspects of notion of relational similarity by the fact that and her some ways there is in Warm Up. 1.. . If . ∆. QRS.  . ∆. ZYX. , identify the pairs of congruent angles and the pairs of congruent sides.. Solve each proportion.. 2.. . 3.. . . x . = 9. x . = 18. . Q. By Brit Caswell. What is a Dilation?. Pg. 587. A stretch! . Think of Ant Man!. Is a dilation a rigid motion?. If the scale factor is . <. 1. , the dilation is called a . reduction. .. If the scale factor is . Jing . Zhang, . Jie. . Tang . , Cong . Ma . , . Hanghang. . Tong . , Yu . Jing . , and . Juanzi. . Li. Presented by Moumita Chanda Das . Outline. Introduction. Problem formulation. Panther using path sampling. I can. :. I can define dilations as a reduction or enlargement of a figure.. I can identify the scale factor of the dilation.. Vocabulary. :. Dilations. Center of Dilation. Similar. Scale Factor. Enlargement. Draw dilations.. Draw dilations in the coordinate plane.. Definitions. A . dilation. or scaling is a similarity transformation that enlarges or reduces a figure proportionally with respect to a center point and a scale factor.. Session Objectives. Examine the development of mathematical understanding across the module using a focus on concept development within the lessons.. Identify the . big idea . within each topic in order to support instructional choices that achieve the lesson objectives while maintaining rigor within the curriculum.. Jessica Chackoria. 1. , Brooke Nyberg. 1. , Melissa Vazquez. 1 . Suzanne Bell. 2. , . Alla. Vinokhodova. 3. , Vadim Gushin. 3. , Leslie DeChurch. 4 . , Noshir Contractor. 4 . 1. DePaul University, .