PPT-Lecture 08 PROTEIN SEQUENCE

ANALYSIS PROTEIN DATABASES PROTEIN SEQUENCE MOTIFDOMAIN FOLDINDING PROPERTIES TOOLS httptwexpasyorg httpwwwebiacukToolspfaiprscan httpwwwncbinlmnihgovStructurecddwrpsbcgi. mzIdentML. ProteinDetectionList. ProteinAmbiguityGroup. id=“PAG1”. ProteinDetectionHypothesis. id=“PDH1” . dbseq_ref. =“dbseq_Q05421|CP2E1_MOUSE”. . anchor protein. ProteinAmbiguityGroup. Gustavo Caetano - . Anolles. 1. PowerPoint by Casey . Hanson. Protein Sequence, Structure, and Function | Gustavo Caetano - Anolles | 2015. Exercise. In this exercise we will be doing the following:. (endoplasmic reticulum). Dr. Mamoun Ahram. Faculty of Medicine. Second year, Second semester, 2014-2014. Principles of Genetics and Molecular Biology. An overview. Endoplasmic reticulum (ER). It is a network of membrane-enclosed tubules and sacs (. Exercise – Project Layout. G. eneral remarks – recap: Report 60pts, Exam 40 . pts. , weekly presentations of each group, one bad presentation allowed, groups of 3-4 students. Contact & Questions: . How Lab IT Accelerates . Pharmaceutical . Research. For more information, see . http. ://ich.vscht.cz. /~. svozil/teaching.html. Last lecture summary. Flavors of sequence alignment. Homology. Scoring DNA alignment, gaps. Synapse-Associated Protein 97. Wu et al, 2002. EMBO J 19:5740-5751. Domain Analysis and Protein Families. Introduction. What are protein families?. Motifs and Profiles. The modular architecture of proteins. Concepts. Introduction to Biostatistics and Bioinformatics. Sequence . Database Searching. This Lecture. Stuart M. Brown, Ph.D.. Center for Health Informatics and Bioinformatics. NYU School of Medicine. Hsin. -Yu Chang. www.ebi.ac.uk. Classifying . proteins into families and . identifying . protein homologues can help scientists . to . characterise. unknown proteins. . . . Greider. and Blackburn discovered telomerase in 1984 and were awarded Nobel prize in 2009. Which model organism they used for this study ? . DNA - the basics. Drew Berry – DNA animations. http://. www.youtube.com. /. watch?v. =. WFCvkkDSfIU&index. =4&list=PL9CBBEA5A85DBCDEF. Organisation of DNA. DNA is packed in Chromosomes . Karyotype: chromosome set of a species . VBC-603. P.G.. 02.01.2021. Knowledge Based Approaches. Homology Modelling. Need homologues of known protein structure. Backbone modelling. Side chain modelling . Fail in absence of homology. Threading Based Methods. (which 432Chemistry 1980COPYING PROCEDURESIn the RNA field these procedures had been pioneered by C. Weissmann andhis colleagues (6) in their studies on the RNA sequence of the bacteriophage contain pair-wise alignment. × . multiple . sequence . alignment. Flavors of sequence alignment. global alignment . × . local alignment. global. local. align entire sequence. stretches of sequence with the highest density of matches . 8 . – . Protein Sequence Analysis. Petrus Tang, Ph.D. (. 鄧致剛. ). Graduate Institute of Basic Medical Sciences. and. Bioinformatics Center, Chang Gung University. .. petang@mail.cgu.edu.tw. EXT: . Secondary structures. Tertiary structures. MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDNGVDGEWTYTE. helices. strands. loops. Three dimensional packing of secondary structures. Protein Structures. Protein structures.