PPT-Prediction of protein features.

Author : giovanna-bartolotta | Published Date : 2017-07-25

Beyond protein structure Miguel Andrade Faculty of Biology Johannes Gutenberg University Institute of Molecular Biology Mainz Germany a ndradeunimainzde Transmembrane

Presentation Embed Code

Download Presentation

Download Presentation The PPT/PDF document "Prediction of protein features." is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.

Prediction of protein features.: Transcript


Beyond protein structure Miguel Andrade Faculty of Biology Johannes Gutenberg University Institute of Molecular Biology Mainz Germany a ndradeunimainzde Transmembrane helices Nterminal signals. Why do we want to know protein structure?. Classification. Functional Prediction. What is protein structure?. Primary - chains of amino acids. Secondary - interaction between groups of amino acids. Tertiary - the organization in three dimensions of all the atoms in a polypeptide. Saehoon Kim. §. , . Yuxiong He. *. ,. . Seung-won Hwang. §. , . Sameh Elnikety. *. , . Seungjin Choi. §. §. *. Web Search Engine . Requirement. 2. Queries. High quality + Low latency. This talk focuses on how to achieve low latency without compromising the quality. Yongin. Kwon, . Sangmin. Lee, . Hayoon. Yi, . Donghyun. Kwon, . Seungjun. Yang, . Byung. -. Gon. Chun,. Ling Huang, . Petros. . Maniatis. , . Mayur. . Naik. , . Yunheung. . Paek. USENIX ATC’13. sparsity. in web search click data. Qi . Guo. , Dmitry . Lagun. , . Denis Savenkov. , . Qiaoling. Liu. [qguo3. ,dlagun,denis.savenkov,. qiaoling.liu. ]. @. emory.edu. Mathematics . & . Computer . Miguel . Andrade. Faculty of Biology, . Johannes Gutenberg University . Institute of Molecular Biology. Mainz, Germany. a. ndrade@uni-mainz.de. X-ray crystallography . (103,988 . in PDB). need crystals. N.N. (GI/MR/M) / N.N. (GI/MR/M). Introduction. bbb. Figure. . 1. Nucleic Acid – Protein Interaction . DataBase. . Figure. 2 . SCOP . family. . characteristic. . Figure. . 3 . Classification of protein-DNA interactions. Advisor: Dr. Chen . Keasar. Arie Barsky, Nadav Nuni. Protein folding problem. Proteins are responsible for constructing and operating the organism, and are made of chains of amino-acids. Protein folding problem. - 2 - Abstract Background Accurate identification of protein domain boundaries is useful for protein structure determination and prediction. However, predicting protein domain boundaries from a sequ VBC-603. P.G.. 30.12.2020. Protein . Strucuture. Sequence, Structure and Function. What determines fold?. Anfinsen’s experiments in 1957 demonstrated that proteins can fold spontaneously into their native conformations under physiological conditions. This implies that primary structure does indeed determine folding or 3-D . Saehoon Kim. §. , . Yuxiong He. *. ,. . Seung-won Hwang. §. , . Sameh Elnikety. *. , . Seungjin Choi. §. §. *. Web Search Engine . Requirement. 2. Queries. High quality + Low latency. This talk focuses on how to achieve low latency without compromising the quality. VBC-603. P.G.. 02.01.2021. Knowledge Based Approaches. Homology Modelling. Need homologues of known protein structure. Backbone modelling. Side chain modelling . Fail in absence of homology. Threading Based Methods. Prediction . Wang Yang. 2014.1.3. Outline. Molecular. . Co-evolution . phenomenon. A. pplications . of Co-evolution . in . protein structure prediction and PPI prediction.. Co-evolution measurement: . Time. Andrey. . Kupavskii. , . Liudmila. . Ostroumova. , Alexey . Umnov. , . Svyatoslav. . Usachev. , . Pavel. . Serdyukov. ,. . . Gleb. . Gusev. , . Andrey. Secondary structures. Tertiary structures. MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDNGVDGEWTYTE. helices. strands. loops. Three dimensional packing of secondary structures. Protein Structures. Protein structures.

Download Document

Here is the link to download the presentation.
"Prediction of protein features."The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.

Related Documents