PPT-Similarity Search in Visual Data

Author : karlyn-bohler | Published Date : 2016-12-20

PhD Thesis Defense Anoop Cherian Department of Computer Science and Engineering University of Minnesota TwinCities Adviser Prof Nikolaos Papanikolopoulos Contact

Presentation Embed Code

Download Presentation

Download Presentation The PPT/PDF document "Similarity Search in Visual Data" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.

Similarity Search in Visual Data: Transcript

PhD Thesis Defense Anoop Cherian Department of Computer Science and Engineering University of Minnesota TwinCities Adviser Prof Nikolaos Papanikolopoulos Contact cheriancsumnedu. Presented by:. Akshay. Kumar. Pankaj. . Prateek. Are these similar?. Number ‘1’ vs. color ‘red’. Number ‘1’ vs. ‘small’. Horse vs. Rider. True vs. false . ‘. Monalisa. ’ vs. ‘Virgin of the rocks’. Sarah Theobald & . Nestor Matthews. Department of Psychology, Denison University, Granville OH 43023 USA. . . The human brain is constantly being presented with complex visual information from all locations. As the retina receives information from either the left or right visual field, or hemifield, the information is processed predominately in the contralateral hemisphere. The brain’s ability to integrate visual information in the cortex allows for a perceptually unified experience when receiving visual information from all locations. However, not all lateralities are “created equal”. . Corpora and Statistical Methods. Lecture 6. Semantic similarity. Part 1. Synonymy. Different phonological. /orthographic. words. highly related meanings. :. sofa / couch. boy / lad. Traditional definition:. Theory and Applications. Danai Koutra (CMU). Tina Eliassi-Rad (Rutgers) . Christos Faloutsos (CMU). SDM 2014. , Friday April 25. th. 2014, Philadelphia, PA. Who we are. Danai Koutra, CMU. Node and graph similarity,. -. based Clustering. Mohammad. . Rezaei. , Pasi Fränti. rezaei@cs.uef.fi. Speech. and . Image. . Processing. . Unit. University of Eastern Finland. . August 2014. Keyword-Based Clustering. An object such as a text document, website, movie and service can be described by a set of keywords. Thomas Berg and Peter N. . Belhumeur. Columbia University. Outline. Introduction. Visual . Similarity. A Visual Field Guide to . Birds. Conclusions. Introduction. “Can a . recognition system show humans what to look for . CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. WordNet. Lubomir. . Stanchev. Example . Similarity Graph. Dog. Cat. 0.3. 0.3. Animal. 0.8. 0.2. 0.8. 0.2. Applications. If we type . automobile. . in our favorite Internet search engine, for example Google or Bing, then all top results will contain the word . these theories have explanatory power domains partially role of relational judgments. Previous structural and aspects of notion of relational similarity by the fact that and her some ways there is in Warm Up. 1.. . If . ∆. QRS.  . ∆. ZYX. , identify the pairs of congruent angles and the pairs of congruent sides.. Solve each proportion.. 2.. . 3.. . . x . = 9. x . = 18. . Q. Jing . Zhang, . Jie. . Tang . , Cong . Ma . , . Hanghang. . Tong . , Yu . Jing . , and . Juanzi. . Li. Presented by Moumita Chanda Das . Outline. Introduction. Problem formulation. Panther using path sampling. a Multi-Layered Indexing Approach. Yongjiang Liang, . Peixiang Zhao. CS @ FSU. zhao@cs.fsu.edu. Outline. Introduction. State-of-the-art solutions. ML-Index & similarity search. Experiments. Conclusion. Warm Up. Solve each proportion.. 1.. . . 2.. . 3.. 4. . If . ∆. QRS . ~ . ∆. XYZ. , identify the pairs of congruent angles and write 3 proportions using pairs of corresponding sides.. . Here are some of the most strange moments ever caught on camera!

Like and sub! :D
-
football, basketball, soccer, tennis, and more!
-
In this video we commentate/report about some strange moments that happened with a main focus in sports, we also add edits in the clips to make it more entertaining!
-
Thanks Elliot for helping with the voice over https://shrinklink.in/HoUPYHka https://uii.io/xqqhLc

Download Document

Here is the link to download the presentation.
"Similarity Search in Visual Data"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.