PPT-On the Effectiveness of Distance Measures for Similarity Se
Author : pasty-toler | Published Date : 2017-11-10
June 8 th 2017 International Conference on Multimedia Retrieval ICMR 2017 Bucharest Romania Yash Garg CIDSE Arizona State University Tempe USA 85281 ygargasuedu
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "On the Effectiveness of Distance Measure..." is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
On the Effectiveness of Distance Measures for Similarity Se: Transcript
June 8 th 2017 International Conference on Multimedia Retrieval ICMR 2017 Bucharest Romania Yash Garg CIDSE Arizona State University Tempe USA 85281 ygargasuedu Silvestro Roberto Poccia. Presented by:. Akshay. Kumar. Pankaj. . Prateek. Are these similar?. Number ‘1’ vs. color ‘red’. Number ‘1’ vs. ‘small’. Horse vs. Rider. True vs. false . ‘. Monalisa. ’ vs. ‘Virgin of the rocks’. Input for Multidimensional Scaling and Clustering. Distances and Similarities. Both are ways of measuring how similar two objects are. Distances increase as objects are less similar. The distance of an object to itself is 0. energies. D.A. . Artemenkov. , G.I. . . Lykasov. , . A.I. . . Malakhov. Joint Institute for Nuclear Research. malakhov@lhe.jinr.ru. Hadron Structure 2015, June 29 – July 3, 2015, . Horn. ý. . . -. based Clustering. Mohammad. . Rezaei. , Pasi Fränti. rezaei@cs.uef.fi. Speech. and . Image. . Processing. . Unit. University of Eastern Finland. . August 2014. Keyword-Based Clustering. An object such as a text document, website, movie and service can be described by a set of keywords. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. Ciro . Cattuto. , Dominik Benz, Andreas . Hotho. , . Gerd. . Stumme. Presented by. Smitashree. . Choudhury. Overview. Motivation. Measures of . semantic Relatedness. Semantic . Grounding of measures. Pattern Recognition . 2015/2016. Marc van Kreveld. Measures in mathematics. Functions from “subsets” to the reals. A . measure. obeys the properties:. Non-. negativeness. : for any subset X, f(X) . Word . Similarity: . Distributional Similarity (I). Problems with thesaurus-based . meaning. We don’t have a thesaurus for every language. Even if we do, . they have problems with . recall. M. any . a Multi-Layered Indexing Approach. Yongjiang Liang, . Peixiang Zhao. CS @ FSU. zhao@cs.fsu.edu. Outline. Introduction. State-of-the-art solutions. ML-Index & similarity search. Experiments. Conclusion. CSE, HKUST. March 20. Recap. String declaration. str1=“Hong”. str2=“Kong”. String Operators. strr. =str1+str2. “H” in . strr. String Slicing. strr. [. i. ]. strr. [:. i. ]. strr. [. i. :]. Presenter. : Monica Farkash. Bryan Hickerson. . mfarkash@us.ibm.com. . bhickers@us.ibm.com. . 2. Outline. The challenge: Providing a subset from a regression test suite. Our new Jaccard/K-means (JK) approach . Quiz. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. 3. Deer-mouse. 4. Deer-roof. Quiz Answer. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. Fabian Wagner. fabian@iiasa.ac.at. SPIPA GAINS Training, 12-16 April 2021. 2. Activity-based emissions inventory (AP/GHG). Simulation of future scenarios/incl. What if policies were implemented? (AP/GHG). Financial Services. Dhagash. Mehta. BlackRock, Inc.. Disclaimer: The views expresses here are those of the authors alone and not of BlackRock, Inc.. Introduction: Similarity. Scene from Alice’s Adventures in Wonderland by Lewis Carroll, 1865. Artist: John Tenniel.
Download Document
Here is the link to download the presentation.
"On the Effectiveness of Distance Measures for Similarity Se"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
Related Documents
