PPT-Scheduled Sampling for Sequence Prediction with Recurrent N

SBengio OVinyals NJaitly NShazeer arXiv150603099 Present by Hanyi Zhang Contents Sequence Prediction Recurrent Neural Network Problem Description and Proposed Models Training using scheduled sampling. Outline. Some Sample NLP Task . [Noah Smith]. Structured Prediction For NLP. Structured Prediction Methods. Conditional Random Fields. Structured . Perceptron. Discussion. Motivating Structured-Output Prediction for NLP. l Networks. Presente. d by:. Kunal Parmar. UHID: 1329834. 1. Outline of the presentation . Introduction. Supervised Sequence Labelling. Recurrent Neura. l Networks. How can RNNs be used for supervised sequence labelling?. Miguel . Andrade. Faculty of Biology, . Johannes Gutenberg University . Institute of Molecular Biology. Mainz, Germany. a. ndrade@uni-mainz.de. X-ray crystallography . (103,988 . in PDB). need crystals. Example Application. Slot Filling. I would like to arrive . Taipei . on . November 2. nd. .. . ticket booking system. Destination:. time of arrival:. Taipei. November 2. nd. . Slot. Example Application. What should you expect?. A scheduled message can be made to one individual or to a group of people. . In this demonstration we will be going over an . individual scheduled message. . Scheduled messages can be found under the contacts individual conversation box or in the scheduled messages calendar.. Given a domain, we can reduce the prediction error by good choice of the sampling points.. The choice of sampling locations is called “design of experiments” or DOE.. In this lecture we will consider DOEs for linear regression using linear and quadratic polynomials and where errors are due to noise in the data.. Given the resources in a practical situation, the predictor that is capable of possibly meeting these requirements has to be a member of the set of all possible finite state machines (FSM Section 1: Introduction and biological databases.. Section 2: Sequence alignment.. Section 3: Gene and promoter prediction.. Section 4: Molecular phylogenetics.. Section 5: Structural Bioinformatics. Lecture 3. Gene Finding and Sequence Annotation. Objectives of this lecture. Introduce you to basic concepts and approaches of gene finding. Show you differences between gene prediction for prokaryotic and eukaryotic genomes. . Miguel . Andrade. Faculty of Biology, . Johannes Gutenberg University . Institute of Molecular Biology. Mainz, Germany. a. ndrade@uni-mainz.de. Secondary structure prediction. Amino acid sequence -> Secondary structure. 386 Volume 7 I ssue 4 December 2016 ISSN: 2319 - 1058 Expressed Sequence Tags and Gene Prediction Neeta Maitre Department of Computer Science and Engineering G. H. Raisoni College of Engineering, Models and applications. Outline. Sequence Data. Recurrent Neural Networks Variants. Handling Long Term Dependencies. Attention Mechanisms. Properties of RNNs. Applications of RNNs. Hands-on LSTM-supported timeseries prediction. Secondary structures. Tertiary structures. MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDNGVDGEWTYTE. helices. strands. loops. Three dimensional packing of secondary structures. Protein Structures. Protein structures. Human Language Technologies. Giuseppe Attardi. Some slides from . Arun. . Mallya. Università di Pisa. Recurrent. RNNs are called . recurrent.  because they perform the same task for every element of a sequence, with the output depending on the previous values..