PPT-Improving Distributional Similarity
Author : faustina-dinatale | Published Date : 2018-10-04
with Lessons Learned from Word Embeddings Presented by Jiaxing Tan Some Slides from the original paper presentation 1 Outline Background Hyperparameter to experiment
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "Improving Distributional Similarity" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
Improving Distributional Similarity: Transcript
with Lessons Learned from Word Embeddings Presented by Jiaxing Tan Some Slides from the original paper presentation 1 Outline Background Hyperparameter to experiment Experiment and Result. Presented by:. Akshay. Kumar. Pankaj. . Prateek. Are these similar?. Number ‘1’ vs. color ‘red’. Number ‘1’ vs. ‘small’. Horse vs. Rider. True vs. false . ‘. Monalisa. ’ vs. ‘Virgin of the rocks’. Bamshad Mobasher. DePaul University. Distance or Similarity Measures. Many data mining and analytics tasks involve the comparison of objects and determining . their . similarities (or dissimilarities). energies. D.A. . Artemenkov. , G.I. . . Lykasov. , . A.I. . . Malakhov. Joint Institute for Nuclear Research. malakhov@lhe.jinr.ru. Hadron Structure 2015, June 29 – July 3, 2015, . Horn. ý. . . from . GOMMA. Michael . Hartung. , Lars Kolb, . Anika. . Groß. , Erhard Rahm. Database . Research Group. University of . Leipzig. 9th . Intl. . . Conf. . on Data Integration. in . the. Life . Sciences. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. Harris T. Lin. , . Sanghack. Lee, . Ngot. Bui and . Vasant. . Honavar. Artificial Intelligence Research Laboratory. Department of Computer Science. Iowa State University. htlin@iastate.edu. Introduction. Word . Similarity: . Distributional Similarity (I). Problems with thesaurus-based . meaning. We don’t have a thesaurus for every language. Even if we do, . they have problems with . recall. M. any . a Multi-Layered Indexing Approach. Yongjiang Liang, . Peixiang Zhao. CS @ FSU. zhao@cs.fsu.edu. Outline. Introduction. State-of-the-art solutions. ML-Index & similarity search. Experiments. Conclusion. CSE, HKUST. March 20. Recap. String declaration. str1=“Hong”. str2=“Kong”. String Operators. strr. =str1+str2. “H” in . strr. String Slicing. strr. [. i. ]. strr. [:. i. ]. strr. [. i. :]. S. imilarity to Semantic Relations. Georgeta. . Bordea. , November 25. Based on a talk by Alessandro . Lenci. . titled “Will DS ever become Semantic?”, Jan 2014. Distributional Semantics . (DS. in Lexical Typology:. Constructing a typological questionnaire. Daria . Ryzhova. School of Linguistics. NRU HSE. Outline. Lexical Typology: Frame-based Approach. Ideology. Typological questionnaire. with Lessons Learned from Word Embeddings. Omer Levy. . . Yoav. Goldberg . Ido. Dagan. Bar-. Ilan. University. Israel. 1. Word Similarity & Relatedness. How similar is . pizza. to . Quiz. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. 3. Deer-mouse. 4. Deer-roof. Quiz Answer. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. Erk. You can get an idea of what a word means from observing it in context. He filled the . wampimuk. , passed it around, and we all drank some. We found a little hairy . wampimuk. . sleeping behind a tree. .
Download Document
Here is the link to download the presentation.
"Improving Distributional Similarity"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
Related Documents