PPT-Statistical Similarity

Author : luanne-stotts | Published Date : 2018-01-22

of Binaries Yaniv David Nimrod Partush Eran Yahav The research leading to these results has received funding from the European Unions Seventh Framework

Presentation Embed Code

Download Presentation

Download Presentation The PPT/PDF document "Statistical Similarity" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.

Statistical Similarity: Transcript

of Binaries Yaniv David Nimrod Partush Eran Yahav The research leading to these results has received funding from the European Unions Seventh Framework Programme FP7 under grant agreement n . brPage 1br Statistical Rejection of Bad Data Chauvenets Criterion statistical Chauvenets criterion brPage 2br once Example 4 SOLUTION Presented by:. Akshay. Kumar. Pankaj. . Prateek. Are these similar?. Number ‘1’ vs. color ‘red’. Number ‘1’ vs. ‘small’. Horse vs. Rider. True vs. false . ‘. Monalisa. ’ vs. ‘Virgin of the rocks’. Theory and Applications. Danai Koutra (CMU). Tina Eliassi-Rad (Rutgers) . Christos Faloutsos (CMU). SDM 2014. , Friday April 25. th. 2014, Philadelphia, PA. Who we are. Danai Koutra, CMU. Node and graph similarity,. -. based Clustering. Mohammad. . Rezaei. , Pasi Fränti. rezaei@cs.uef.fi. Speech. and . Image. . Processing. . Unit. University of Eastern Finland. . August 2014. Keyword-Based Clustering. An object such as a text document, website, movie and service can be described by a set of keywords. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. WordNet. Lubomir. . Stanchev. Example . Similarity Graph. Dog. Cat. 0.3. 0.3. Animal. 0.8. 0.2. 0.8. 0.2. Applications. If we type . automobile. . in our favorite Internet search engine, for example Google or Bing, then all top results will contain the word . Warm Up. 1.. . If . ∆. QRS.  . ∆. ZYX. , identify the pairs of congruent angles and the pairs of congruent sides.. Solve each proportion.. 2.. . 3.. . . x . = 9. x . = 18. . Q. Case-based reasoning. Introduction. Common term in everyday language, where two objects usually are considered similar if they look or sound similar. Similarity is a core concept within CBR. From a CBR perspective: «Two problems are similar if they have similar solutions». CSE, HKUST. March 20. Recap. String declaration. str1=“Hong”. str2=“Kong”. String Operators. strr. =str1+str2. “H” in . strr. String Slicing. strr. [. i. ]. strr. [:. i. ]. strr. [. i. :]. Richard Montes, Ph.D.. Hospira. , a Pfizer company. Biosimilars Pharmaceutical . Sciences (Statistics). Presentation Outline. Background on demonstration . of biosimilarity. Tier . 1 . (Equivalence Testing). Bamshad Mobasher. DePaul University. Distance or Similarity Measures. Many data mining and analytics tasks involve the comparison of objects and determining in terms of their similarities (or dissimilarities). Presenter. : Monica Farkash. Bryan Hickerson. . mfarkash@us.ibm.com. . bhickers@us.ibm.com. . 2. Outline. The challenge: Providing a subset from a regression test suite. Our new Jaccard/K-means (JK) approach . Text Similarity. Motivation. People can express the same concept (or related concepts) in many different ways. For example, “the plane leaves at 12pm” vs “the flight departs at noon”. Text similarity is a key component of Natural Language Processing. Sketching, Locality Sensitive Hashing. SIMILARITY AND DISTANCE. Thanks to:. Tan, Steinbach, . and Kumar, “Introduction to Data Mining”. Rajaraman. . and . Ullman, “Mining Massive Datasets”. Similarity and Distance.

Download Document

Here is the link to download the presentation.
"Statistical Similarity"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.