PPT-Image Similarity

Decision Network ConvNet Extracted Book Cover N Extracted Book Cover 2 Extracted Book Cover 1 Search Target Predicting Visual Search Targets via Eye Tracking Data Predict visual search targets in closed and open world settings . Presented by:. Akshay. Kumar. Pankaj. . Prateek. Are these similar?. Number ‘1’ vs. color ‘red’. Number ‘1’ vs. ‘small’. Horse vs. Rider. True vs. false . ‘. Monalisa. ’ vs. ‘Virgin of the rocks’. Bamshad Mobasher. DePaul University. Distance or Similarity Measures. Many data mining and analytics tasks involve the comparison of objects and determining . their . similarities (or dissimilarities). Corpora and Statistical Methods. Lecture 6. Semantic similarity. Part 1. Synonymy. Different phonological. /orthographic. words. highly related meanings. :. sofa / couch. boy / lad. Traditional definition:. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. WordNet. Lubomir. . Stanchev. Example . Similarity Graph. Dog. Cat. 0.3. 0.3. Animal. 0.8. 0.2. 0.8. 0.2. Applications. If we type . automobile. . in our favorite Internet search engine, for example Google or Bing, then all top results will contain the word . Warm Up. 1.. . If . ∆. QRS.  . ∆. ZYX. , identify the pairs of congruent angles and the pairs of congruent sides.. Solve each proportion.. 2.. . 3.. . . x . = 9. x . = 18. . Q. Word . Similarity: . Distributional Similarity (I). Problems with thesaurus-based . meaning. We don’t have a thesaurus for every language. Even if we do, . they have problems with . recall. M. any . Jing . Zhang, . Jie. . Tang . , Cong . Ma . , . Hanghang. . Tong . , Yu . Jing . , and . Juanzi. . Li. Presented by Moumita Chanda Das . Outline. Introduction. Problem formulation. Panther using path sampling. . Juri . Minxha. Medical Image Analysis. Professor Benjamin Kimia. Spring 2011. Brown University. Problem Statement. 2 Signal Sources . - 3D . volumetric data . (CT scan, MRI). - 2D images (ex. frame from fluoroscopy video). CS159 . Fall . 2014. Admin. Assignment 4. Quiz #2 Thursday. Same . rules as quiz #1. First 30 minutes of class. Open book and . notes. Assignment 5 out on Thursday. Quiz #2. Topics. Linguistics 101. Parsing. Warm Up. Solve each proportion.. 1.. . . 2.. . 3.. 4. . If . ∆. QRS . ~ . ∆. XYZ. , identify the pairs of congruent angles and write 3 proportions using pairs of corresponding sides.. . Bamshad Mobasher. DePaul University. Distance or Similarity Measures. Many data mining and analytics tasks involve the comparison of objects and determining in terms of their similarities (or dissimilarities). Jessica Chackoria. 1. , Brooke Nyberg. 1. , Melissa Vazquez. 1 . Suzanne Bell. 2. , . Alla. Vinokhodova. 3. , Vadim Gushin. 3. , Leslie DeChurch. 4 . , Noshir Contractor. 4 . 1. DePaul University, . Financial Services. Dhagash. Mehta. BlackRock, Inc.. Disclaimer: The views expresses here are those of the authors alone and not of BlackRock, Inc.. Introduction: Similarity. Scene from Alice’s Adventures in Wonderland by Lewis Carroll, 1865. Artist: John Tenniel.