PPT-Image Similarity

Author : giovanna-bartolotta | Published Date : 2017-05-20

Decision Network ConvNet Extracted Book Cover N Extracted Book Cover 2 Extracted Book Cover 1 Search Target Predicting Visual Search Targets via Eye Tracking Data

Presentation Embed Code

Download Presentation

Download Presentation The PPT/PDF document "Image Similarity" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.

Image Similarity: Transcript


Decision Network ConvNet Extracted Book Cover N Extracted Book Cover 2 Extracted Book Cover 1 Search Target Predicting Visual Search Targets via Eye Tracking Data Predict visual search targets in closed and open world settings . Presented by:. Akshay. Kumar. Pankaj. . Prateek. Are these similar?. Number ‘1’ vs. color ‘red’. Number ‘1’ vs. ‘small’. Horse vs. Rider. True vs. false . ‘. Monalisa. ’ vs. ‘Virgin of the rocks’. Bamshad Mobasher. DePaul University. Distance or Similarity Measures. Many data mining and analytics tasks involve the comparison of objects and determining . their . similarities (or dissimilarities). Corpora and Statistical Methods. Lecture 6. Semantic similarity. Part 1. Synonymy. Different phonological. /orthographic. words. highly related meanings. :. sofa / couch. boy / lad. Traditional definition:. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. WordNet. Lubomir. . Stanchev. Example . Similarity Graph. Dog. Cat. 0.3. 0.3. Animal. 0.8. 0.2. 0.8. 0.2. Applications. If we type . automobile. . in our favorite Internet search engine, for example Google or Bing, then all top results will contain the word . Warm Up. 1.. . If . ∆. QRS.  . ∆. ZYX. , identify the pairs of congruent angles and the pairs of congruent sides.. Solve each proportion.. 2.. . 3.. . . x . = 9. x . = 18. . Q. Word . Similarity: . Distributional Similarity (I). Problems with thesaurus-based . meaning. We don’t have a thesaurus for every language. Even if we do, . they have problems with . recall. M. any . Jing . Zhang, . Jie. . Tang . , Cong . Ma . , . Hanghang. . Tong . , Yu . Jing . , and . Juanzi. . Li. Presented by Moumita Chanda Das . Outline. Introduction. Problem formulation. Panther using path sampling. . Juri . Minxha. Medical Image Analysis. Professor Benjamin Kimia. Spring 2011. Brown University. Problem Statement. 2 Signal Sources . - 3D . volumetric data . (CT scan, MRI). - 2D images (ex. frame from fluoroscopy video). CS159 . Fall . 2014. Admin. Assignment 4. Quiz #2 Thursday. Same . rules as quiz #1. First 30 minutes of class. Open book and . notes. Assignment 5 out on Thursday. Quiz #2. Topics. Linguistics 101. Parsing. Warm Up. Solve each proportion.. 1.. . . 2.. . 3.. 4. . If . ∆. QRS . ~ . ∆. XYZ. , identify the pairs of congruent angles and write 3 proportions using pairs of corresponding sides.. . Bamshad Mobasher. DePaul University. Distance or Similarity Measures. Many data mining and analytics tasks involve the comparison of objects and determining in terms of their similarities (or dissimilarities). Jessica Chackoria. 1. , Brooke Nyberg. 1. , Melissa Vazquez. 1 . Suzanne Bell. 2. , . Alla. Vinokhodova. 3. , Vadim Gushin. 3. , Leslie DeChurch. 4 . , Noshir Contractor. 4 . 1. DePaul University, . Financial Services. Dhagash. Mehta. BlackRock, Inc.. Disclaimer: The views expresses here are those of the authors alone and not of BlackRock, Inc.. Introduction: Similarity. Scene from Alice’s Adventures in Wonderland by Lewis Carroll, 1865. Artist: John Tenniel.

Download Document

Here is the link to download the presentation.
"Image Similarity"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.

Related Documents