PPT-Musical Similarity:
Author : myesha-ticknor | Published Date : 2017-06-29
More perspectives and compound techniques CS 275BMusic 254 Musical similarity Similarity studies in general Reductionist approaches Social cognition Timbral confounds
Presentation Embed Code
Download Presentation
Download Presentation The PPT/PDF document "Musical Similarity:" is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.
Musical Similarity:: Transcript
More perspectives and compound techniques CS 275BMusic 254 Musical similarity Similarity studies in general Reductionist approaches Social cognition Timbral confounds Affective similarity. energies. D.A. . Artemenkov. , G.I. . . Lykasov. , . A.I. . . Malakhov. Joint Institute for Nuclear Research. malakhov@lhe.jinr.ru. Hadron Structure 2015, June 29 – July 3, 2015, . Horn. ý. . . . Multi-label Protein Subcellular Localization. Shibiao WAN and Man-Wai MAK. The Hong Kong Polytechnic University. Sun-Yuan KUNG. Princeton University. Outline. Introduction and Motivation. Retrieval of GO Terms. -. based Clustering. Mohammad. . Rezaei. , Pasi Fränti. rezaei@cs.uef.fi. Speech. and . Image. . Processing. . Unit. University of Eastern Finland. . August 2014. Keyword-Based Clustering. An object such as a text document, website, movie and service can be described by a set of keywords. CMPS 561-FALL 2014. SUMI SINGH. SXS5729. Protein Structure . 2. RPDFCLEPPYAGACRARIIRYFYNAKAGLCQ. Primary Structure. Sequence of Amino Acids. . Not . enough for functional prediction.. Tertiary Structure. WordNet. Lubomir. . Stanchev. Example . Similarity Graph. Dog. Cat. 0.3. 0.3. Animal. 0.8. 0.2. 0.8. 0.2. Applications. If we type . automobile. . in our favorite Internet search engine, for example Google or Bing, then all top results will contain the word . Case-based reasoning. Introduction. Common term in everyday language, where two objects usually are considered similar if they look or sound similar. Similarity is a core concept within CBR. From a CBR perspective: «Two problems are similar if they have similar solutions». a Multi-Layered Indexing Approach. Yongjiang Liang, . Peixiang Zhao. CS @ FSU. zhao@cs.fsu.edu. Outline. Introduction. State-of-the-art solutions. ML-Index & similarity search. Experiments. Conclusion. CSE, HKUST. March 20. Recap. String declaration. str1=“Hong”. str2=“Kong”. String Operators. strr. =str1+str2. “H” in . strr. String Slicing. strr. [. i. ]. strr. [:. i. ]. strr. [. i. :]. Basic Issues in Folksong Research. 5/16/2011. 1. Eleanor Selfridge-Field. Basic . Factors in Folksong Research. Format . considerations. Repertory. considerations. Cultural . considerations. 5/16/2011. . Una obra teatral musical se caracteriza porque además de los elementos teatrales principales combina música, canción, diálogo y baile. . Se representa en grandes escenarios, como los teatros de West End o en Broadway. También hay películas que se han adaptado a obras teatrales.. Quiz. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. 3. Deer-mouse. 4. Deer-roof. Quiz Answer. Which pair of words exhibits the greatest similarity?. 1. Deer-elk. 2. Deer-horse. Jessica Chackoria. 1. , Brooke Nyberg. 1. , Melissa Vazquez. 1 . Suzanne Bell. 2. , . Alla. Vinokhodova. 3. , Vadim Gushin. 3. , Leslie DeChurch. 4 . , Noshir Contractor. 4 . 1. DePaul University, . Financial Services. Dhagash. Mehta. BlackRock, Inc.. Disclaimer: The views expresses here are those of the authors alone and not of BlackRock, Inc.. Introduction: Similarity. Scene from Alice’s Adventures in Wonderland by Lewis Carroll, 1865. Artist: John Tenniel. Sketching, Locality Sensitive Hashing. SIMILARITY AND DISTANCE. Thanks to:. Tan, Steinbach, . and Kumar, “Introduction to Data Mining”. Rajaraman. . and . Ullman, “Mining Massive Datasets”. Similarity and Distance.
Download Document
Here is the link to download the presentation.
"Musical Similarity:"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.
Related Documents
